DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hspb7 and Hsp27

DIOPT Version :9

Sequence 1:NP_038896.2 Gene:Hspb7 / 29818 MGIID:1352494 Length:169 Species:Mus musculus
Sequence 2:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster


Alignment Length:159 Identity:37/159 - (23%)
Similarity:58/159 - (36%) Gaps:42/159 - (26%)


- Green bases have known domain annotations that are detailed below.


Mouse    46 MFSDDFG------------SFMLP------------------HSEPLAFPARPGGQGNIKTLG-D 79
            :..||||            ..:||                  |...::..|..|....:..:| |
  Fly    24 LLEDDFGFGVHAHDLFHPRRLLLPNTLGLGRRRYSPYERSHGHHNQMSRRASGGPNALLPAVGKD 88

Mouse    80 AYEFTVDMRDFSPEDIIVTTFNNHIEVRA---EKLAADGTVMNTFAHKCQLPEDVDPTSVTSALR 141
            .::..:|:..|.|.::.|...:|.:.|..   |:....|.:...|..|..||:..||..|.|.:.
  Fly    89 GFQVCMDVSQFKPNELTVKVVDNTVVVEGKHEEREDGHGMIQRHFVRKYTLPKGFDPNEVVSTVS 153

Mouse   142 EDGSLTIRARRHPHTE--------HVQQT 162
            .||.||::|...|..|        .:|||
  Fly   154 SDGVLTLKAPPPPSKEQAKSERIVQIQQT 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hspb7NP_038896.2 Required for localization to SC35 splicing speckles. /evidence=ECO:0000250 1..70 8/53 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
ACD_HspB7_like 72..152 CDD:107234 23/83 (28%)
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 22/76 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.