DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bag3 and Nedd4

DIOPT Version :9

Sequence 1:NP_038891.4 Gene:Bag3 / 29810 MGIID:1352493 Length:577 Species:Mus musculus
Sequence 2:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster


Alignment Length:395 Identity:88/395 - (22%)
Similarity:134/395 - (33%) Gaps:96/395 - (24%)


- Green bases have known domain annotations that are detailed below.


Mouse    22 DPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPPEGPKDTASSANGPSRDGSRLLPI-REGH 85
            |.||.|||.:.| ..|..::|:|.:|||.|:.|.|        .:|.:..|.|....... |..|
  Fly   246 DALPAGWEERQD-ANGRTYYVNHTARTTQWDRPTV--------LNSHSSQSTDDQLASDFQRRFH 301

Mouse    86 PIYPQLRPGYIPIPVLHEGSENRQPHLFHAYSQPGVQRFRTEAAAATPQRSQSPLRGGMTE-AAQ 149
            ........|.....:.|...|:.......||:.      :|.|.::.|..:.:...|.:.: |.|
  Fly   302 ISVDDTESGRSADSISHNSIEDNNNAAGLAYTP------KTAATSSAPPNTPTNNNGILAQIAMQ 360

Mouse   150 TDKQCGQMPATATTA----AAQPPTAH-GPERSQSPAASDCSSSSSSASLPSSG------RSSLG 203
            ...:..|.|....|:    :.:.|.|| .||.|.:...:|......:..:|...      |.:.|
  Fly   361 YRAEEDQDPTVDHTSFVYNSLRHPVAHRQPEISATSLQNDLRPVREAPGVPDIAITNPFTRRAAG 425

Mouse   204 SHQLPRGYIPIPVIHEQNITRPAAQPSFHQAQKTHYPAQQG------EYQPQQPVYHKIQGDDWE 262
            :.....|:       :|...|...|....|.|:.....||.      :::.|:| .|:.|....:
  Fly   426 NMAGGAGW-------QQERRRQQMQLHIQQHQQRQQQQQQNRILLDVDHRQQEP-QHRGQRHQQQ 482

Mouse   263 PRPLRAASPFRSPVRGASSREGSPARSGTPVHCPSPIRVHTVVDRPQPMTHREP-------PPVT 320
            .||               |.|.:   ..|..|.||.|..        |.|.|..       ||:.
  Fly   483 HRP---------------SNEDT---DHTDSHNPSDISA--------PSTRRNSEEDNAAVPPME 521

Mouse   321 QPENKPESKPGPAGPDLPPGHIPIQVI------------RREADSKPVS-QKSPPPAEKVEVKVS 372
            | ....|.:|      ||| ...:||.            ||.....|.: :.||.|.:...|:..
  Fly   522 Q-NTGGEEEP------LPP-RWSMQVAPNGRTFFIDHASRRTTWIDPRNGRASPMPNQTRRVEDD 578

Mouse   373 SAPIP 377
            ..|:|
  Fly   579 LGPLP 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bag3NP_038891.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..81 19/58 (33%)
WW 23..55 CDD:197736 13/31 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..207 19/92 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..427 39/175 (22%)
BAG 426..503 CDD:214591
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 524..577
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809 13/29 (45%)
WW 531..560 CDD:278809 7/29 (24%)
WW 581..613 CDD:197736 2/3 (67%)
HECTc 650..1003 CDD:238033
HECTc 674..1003 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11382
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.