DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mga and bi

DIOPT Version :9

Sequence 1:XP_006499750.1 Gene:Mga / 29808 MGIID:1352483 Length:3091 Species:Mus musculus
Sequence 2:NP_001259238.1 Gene:bi / 31379 FlyBaseID:FBgn0000179 Length:1023 Species:Drosophila melanogaster


Alignment Length:255 Identity:117/255 - (45%)
Similarity:160/255 - (62%) Gaps:19/255 - (7%)


- Green bases have known domain annotations that are detailed below.


Mouse    69 DCTVGKITVTLDNNSMWNEFHNRSTEMILTKQGRRMFPYCRYWITGLDSNLKYILVMDISPVDSH 133
            |..|....|||:...:|.:||...|||::||.||:|||..::.::|||:..||||::||...|.:
  Fly   322 DGVVDDPKVTLEGKDLWEKFHKLGTEMVITKSGRQMFPQMKFRVSGLDAKAKYILLLDIVAADDY 386

Mouse   134 RYKWNGRWWEPSGKAEPHILGRVFIHPESPSTGHYWMHQPVSFYKLKLTNNTLDQEGHI---ILH 195
            |||::...|..:|||:|.:..|::|||:||:||..||.:.|||:|||||||..|:.|.:   ||:
  Fly   387 RYKFHNSRWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKVVSFHKLKLTNNISDKHGFVSTTILN 451

Mouse   196 SMHRYLPRLHLVPAEKATEVIQLNGPGVHTFTFPQTEFFAVTAYQNIQITQLKIDYNPFAKGFRD 260
            |||:|.||.|||   :|.::::|......|:.|.:|||.|||||||.:|||||||.|||||||||
  Fly   452 SMHKYQPRFHLV---RANDILKLPYSTFRTYVFKETEFIAVTAYQNEKITQLKIDNNPFAKGFRD 513

Mouse   261 DGLSSKPQREGKQRNSSDQEGNSVSSSPAH----RVRLTEGEGSEIHSGDFDPVLRGHEA 316
            .|..   :||.||...|::..:|...:|.|    |..|..|     |:|. .|.|..|.|
  Fly   514 TGAG---KREKKQALMSNRGSDSDKLNPTHVSSSRAPLHLG-----HAGR-PPHLHPHAA 564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MgaXP_006499750.1 TBOX 74..264 CDD:238106 98/192 (51%)
DUF4801 1038..1080 CDD:374336
DUF5585 <1510..>1811 CDD:375359
Atrophin-1 1729..>2023 CDD:367360
bHLHzip_MGA 2452..2516 CDD:381481
biNP_001259238.1 Optomotor-blind <260..318 CDD:287988
T-box 330..513 CDD:279278 95/185 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.