DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC8 and CG17197

DIOPT Version :9

Sequence 1:NP_001171953.1 Gene:ZDHHC8 / 29801 HGNCID:18474 Length:778 Species:Homo sapiens
Sequence 2:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster


Alignment Length:225 Identity:56/225 - (24%)
Similarity:86/225 - (38%) Gaps:61/225 - (27%)


- Green bases have known domain annotations that are detailed below.


Human     8 RLKPAKYIPVA-TAAALLVGSSTLFFV-----FTCP-------------WLTRAVSPAVPV-YNG 52
            |..|..::.:: ..|.|.|..:|:|||     :..|             ||.     |:.: || 
  Fly    13 RRNPKIFVRISHPTAVLFVIVTTIFFVVLQMFYVVPQLFDVQGFMYKLGWLV-----AIFITYN- 71

Human    53 IIFLFVLANFSMATFMDPGVFPRADEDEDKEDDFRAPLYKNVDVRGIQVRMKWCATCHFYRPPRC 117
             ||..:||....:|.::.  .|:..:..:.|::.               :..:|..|....|||.
  Fly    72 -IFGNMLACHITSTSVES--LPKDRQIPEPEEEH---------------QWHYCDVCEKLMPPRS 118

Human   118 SHCSVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFLLSLSAHMVGVVAFGLVYVLNHAEGLGAAH 182
            .||.:|..|:...|.||.:..:|:|..|.||||.|.|        .:|.|....|       |.|
  Fly   119 WHCILCKCCILKRDRHCIFTASCVGHNNQRYFFWFTL--------FMALGTGVAL-------ATH 168

Human   183 TTITMAVMCVAGLFF--IPVIGLTGFHVVL 210
            ...|:.....:.|.|  ||...|..|.:|:
  Fly   169 IIATLKYFSYSDLIFLNIPRDNLPPFWLVI 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC8NP_001171953.1 DHHC 99..224 CDD:366691 34/114 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..352
PHA03247 <333..771 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 509..540
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 13/61 (21%)
zf-DHHC 100..>198 CDD:279823 33/127 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.