DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC1 and app

DIOPT Version :10

Sequence 1:NP_037436.1 Gene:ZDHHC1 / 29800 HGNCID:17916 Length:485 Species:Homo sapiens
Sequence 2:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster


Alignment Length:149 Identity:48/149 - (32%)
Similarity:65/149 - (43%) Gaps:32/149 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   135 HCNLCNVDVSARSKHCSACNKCVCGFDHHCKWLNNCVGERNYRLF-LHSVASALLGVLLLVLVAT 198
            :|..|.:....|:.|||.|:.||..|||||.|:.||||:||||.| |..|:.|.|.|.:.....|
  Fly   148 YCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFFYLFLVSLAFLAVFIFSCSVT 212

Human   199 YVFVEFFVNPMRLRTNRH--FEVLKNHTDVWFVFLPAAPVETQAPAILALAALLILLGLLSTALL 261
            ::.:        |....|  |.|:|           |||. |.....:...::..::||..    
  Fly   213 HLVL--------LMKKEHEVFNVIK-----------AAPF-TVIVVFICFFSIWSVIGLAG---- 253

Human   262 GHLLCFHIYLMWHKLTTYE 280
                 ||.||.....||.|
  Fly   254 -----FHTYLTTSDQTTNE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC1NP_037436.1 Mediates interaction with STING1. /evidence=ECO:0000269|PubMed:25299331 1..271 43/138 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41
DHHC 129..284 CDD:396215 48/149 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..358
DPBB_RlpA_EXP_N-like <362..>400 CDD:455124
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 462..485
appNP_648561.2 DHHC 146..270 CDD:396215 48/149 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.