DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC1 and Zdhhc8

DIOPT Version :9

Sequence 1:NP_037436.1 Gene:ZDHHC1 / 29800 HGNCID:17916 Length:485 Species:Homo sapiens
Sequence 2:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster


Alignment Length:246 Identity:67/246 - (27%)
Similarity:100/246 - (40%) Gaps:63/246 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    55 AWLLYLFFAVIGFGILVP----LLPHHWVPAGYACMGAIFAGHLVVHLTAVSIDPA-------DA 108
            ||::.|....:.|  ..|    :..|.||   .|..|.|....|.....|..:||.       |.
  Fly    16 AWIVLLLTTFLFF--FYPCQFYVKSHPWV---LAYQGVITFFVLANFTLATFMDPGIIPKASPDE 75

Human   109 NVRDKSYAGPLPIFNRSQ-HAHVIEDLHCNLCNVDVSARSKHCSACNKCVCGFDHHCKWLNNCVG 172
            :..::..|   |::..:: :...::...|..|......|..|||.||.|:..|||||.|:|||:|
  Fly    76 DCEEELRA---PLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDHHCPWVNNCIG 137

Human   173 ERNYR---LFLHSVASALLGVLLLVLVATYVFVEFFVNPMRLRTNRHFEVLKNHTDVWFVFLPAA 234
            .||||   .||.|::..:|.:..|.||  ||                .:::.|..|       .|
  Fly   138 RRNYRFFFFFLVSLSIHMLSIFSLCLV--YV----------------LKIMPNIKD-------TA 177

Human   235 PVETQAPAILALAALLILLGL---LSTALLGHLLCFHIYLMWHKLTTYEYI 282
            |:           ..:||:||   |:..:.| |..||:.|:....||.|.:
  Fly   178 PI-----------VAIILMGLVTILAIPIFG-LTGFHMVLVSRGRTTNEQV 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC1NP_037436.1 Mediates interaction with STING1. /evidence=ECO:0000269|PubMed:25299331 1..271 63/233 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41
zf-DHHC 129..284 CDD:307600 49/160 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..358
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 462..485
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 49/160 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.