DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GUCY1A2 and Gyc89Da

DIOPT Version :9

Sequence 1:NP_001243353.1 Gene:GUCY1A2 / 2977 HGNCID:4684 Length:763 Species:Homo sapiens
Sequence 2:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster


Alignment Length:686 Identity:160/686 - (23%)
Similarity:295/686 - (43%) Gaps:160/686 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   109 LKRTLQYYEHQVIGYRDAEKNFHNISNRC---SYADHSNKEE--IEDVSGILQ-CTANILGLKFE 167
            |..::|:|..:..|.....|..|.|.  |   |:..|....:  :.|::..|. ||    |..|:
  Fly     5 LYESVQHYVQEEYGVDIWRKVCHIID--CKHNSFKTHQIYPDKLMPDIAEALSACT----GESFD 63

Human   168 EIQKRFGEEFFNICFHEN---ERVLRAVGGTLQDFFNGFDALLEHIRTSFGKQATLESPSFLCKE 229
            .....||..|  :.|..|   ::::|:.|....||....|.:...:|.::.|   ::|||.....
  Fly    64 FCMNFFGRCF--VRFFSNFGYDKMIRSTGRYFCDFLQSIDNIHLIMRFTYPK---MKSPSMQLTN 123

Human   230 LPEGTLMLHYFHPHHIVGFAMLGMIKAAGKKIYRLDVEVEQVANEKLCSDVSNPGNC-------S 287
            :.:...::.|......:...::|.:....::.|.|:::...:.::   :|:|. |..       .
  Fly   124 MDDNGAVILYRSSRTGMSKYLIGQMTEVAREFYGLEIKAYVIESQ---NDISG-GTAGPIKLTDG 184

Human   288 CLTFLIK---ECENTNIM-KNLPQGTSQVPADLR---ISINTFCRAFPFHLMFDPSMSVLQLGE- 344
            .||.::|   :.:|...| |.:  .|...|:.|:   :.::.|...|||..:.:..|.:...|| 
  Fly   185 PLTVIVKYRLDFDNREYMAKRV--NTEAHPSQLKMPTVKLDVFLDLFPFTFVLNHDMKITHAGEK 247

Human   345 ----------GLRKQLRCDTHKVLKFEDC----------------------FEIVSPKVN-ATFE 376
                      |...:....|| |:....|                      ||::....| |.::
  Fly   248 IVETWIMHNPGANPKSFIGTH-VMDLFQCRRPKDTTIDWDTLIQMRAVLFEFELIRTGHNRAAYD 311

Human   377 RVL-----------LRLSTPFVIRTKPEASGSENKD-----------------------KVMEVK 407
            .||           |..:....:....|.|.|...|                       :.:.:|
  Fly   312 AVLNMDFENYDEMDLNEAQTMALAKAQEFSESHPVDDDESAREDEIDPATGERRSSQGLRSILLK 376

Human   408 GQMIHVPESNSILFLGSPCVDKLDELMGRGLHLSDIPIHDATRDVILVGEQ--AKAQDGLKK--- 467
            |||.::.:.:|::||.||.::.||||.|.||:|:|:..|..:|::::.|.|  :|.:...:|   
  Fly   377 GQMFYIKDVDSLIFLCSPLIENLDELHGIGLYLNDLNPHGLSRELVMAGWQHCSKLEIMFEKEEQ 441

Human   468 RMDKLKATLERTHQALEEEKKKTVDLLYSIFPGDVAQQLWQGQQVQARKFDDVTMLFSDIV---- 528
            |.|:|:.:||    ..:..|::..:||||:.|..:|:::...::...:.|::|:::|.:::    
  Fly   442 RSDELEKSLE----LADSWKRQGDELLYSMIPRPIAERMRLSEEQVCQSFEEVSVIFLEVMNVYD 502

Human   529 -GFTAICAQCTPMQVISMLNELYTRFDHQCGFLDIYKVETIGDAYCVAAGLHRKSLCHAKPIALM 592
             |..:|..   .||.::.||::::..|.:.....:|||||:|..|...:|....:..||:....:
  Fly   503 EGLNSIQG---AMQTVNTLNKVFSALDEEIISPFVYKVETVGMVYMAVSGAPDVNPLHAEHACDL 564

Human   593 ALKMMELSEEVLTPDGRPIQPQRSELLFSFPVSIQLVPDQHQSETDLGTEKMRIGIHSGSVLAGV 657
            ||::|:..:                              .|    |:|...:|:||:||.|:|||
  Fly   565 ALRVMKKFK------------------------------AH----DMGDVAIRVGINSGPVVAGV 595

Human   658 VGVRMPRYCLFGNNVTLASKFESGSHPRRINVSPTT 693
            ||.::|||||||:.|..||:.||.|.|.:|.:|..|
  Fly   596 VGQKVPRYCLFGDTVNTASRMESSSDPWKIQLSKYT 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GUCY1A2NP_001243353.1 HNOB <159..270 CDD:285002 21/113 (19%)
HNOBA 316..503 CDD:285003 59/262 (23%)
CYCc 485..705 CDD:214485 61/214 (29%)
Guanylate_cyc 514..729 CDD:278633 54/185 (29%)
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002 35/166 (21%)
HNOBA 218..476 CDD:285003 59/262 (23%)
CYCc 457..643 CDD:214485 61/212 (29%)
Guanylate_cyc 485..662 CDD:278633 54/184 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D245586at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.