DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema3a and Sema1b

DIOPT Version :9

Sequence 1:NP_059006.1 Gene:Sema3a / 29751 RGDID:3657 Length:772 Species:Rattus norvegicus
Sequence 2:NP_001163178.1 Gene:Sema1b / 37007 FlyBaseID:FBgn0016059 Length:770 Species:Drosophila melanogaster


Alignment Length:684 Identity:196/684 - (28%)
Similarity:302/684 - (44%) Gaps:113/684 - (16%)


- Green bases have known domain annotations that are detailed below.


  Rat    51 LANSSSYHTFLLDEERSRLYVGAKDHIFSFNLVNIKDFQKIVWPVSYTRRDECKWAGKDILKECA 115
            :.||:.|.. :||.....:.|||||.|::.:|..:|:..::.|..:...|:.|...||... :|.
  Fly    54 IGNSTDYFK-ILDHNDEFVLVGAKDVIYNVSLNGLKEIARLEWHSTDADRELCALKGKHEW-DCH 116

  Rat   116 NFIKVLKAYNQTHLYACGTGAFHPICTYI--------EVGHHPEDNIFKLQDSHFENGRGKSPYD 172
            |:::|........:..|||.::.|.|.:.        |.|.....:..:.:.|.....:|..||.
  Fly   117 NYLRVYALRPNGEVLLCGTNSYKPRCRHYTPVEVSSEEAGSAGHAHAMRYEVSRDVEAQGLCPYS 181

  Rat   173 PKLLTASLLIDGELYSGTAADFMGRDFAIFRTLGHHHPIRTEQHDSRWLNDPRFISAHLIPESDN 237
            |...:.....||.|||.|.|||.|.|..|:|     ..:||||:|.:.||.|.|:.|       .
  Fly   182 PAHNSTYAFADGHLYSATVADFSGGDPLIYR-----ENLRTEQYDLKQLNQPDFVGA-------I 234

  Rat   238 PEDDKVYFFFRENAIDGEHSGKATHARIGQICKNDFGGHRSLVNKWTTFLKARLICSVPGPNGID 302
            ..:..|.|||||.:::..:.|||.::|:.::||||.||..|....||:||||||.|||||.  ..
  Fly   235 ERNGYVLFFFRELSMEVMNFGKAVYSRVARVCKNDRGGPYSHGKSWTSFLKARLNCSVPGE--FP 297

  Rat   303 THFDELQDVFLMNSKDPKNPIVYGVFTTSSNIFKGSAVCMYSMSDVRRVFLGPYAHRDGPNYQWV 367
            .:|||:|.:..:.....|: ::|.|||||.|...|||||.:::.|:...|.|.:..:......|:
  Fly   298 FYFDEIQAISPIVESGSKS-LIYAVFTTSVNAIPGSAVCAFNVDDILAAFDGEFKSQKDSQSHWL 361

  Rat   368 PYQ-GRVPYPRPGTCPSKTFGGFDSTKDLPDDVITFARSHPAMYNPVFPINNRPIMIKTDVNYQF 431
            |.: .:||.||||.|       .:.::.|....:.|.::||.|...|..::.||::.|.:::::.
  Fly   362 PVEREQVPKPRPGQC-------VEDSRTLTSIAVNFIKNHPLMEEAVPAVHGRPLLTKVNLHHRL 419

  Rat   432 TQIVV-DRVDAEDG-QYDVMFIGTDVGTVLKVVSV----PKETWHDLEEVLLEEMTVFREPTTIS 490
            |.|.| .:|.:..| .|||::.|||.|.|.|.:::    |..|...|:.|::.||.|....|.|.
  Fly   420 TAIAVHPQVKSLSGAYYDVIYSGTDDGKVTKFINILSTHPNSTVDRLKTVVISEMQVLPLGTPIR 484

  Rat   491 AMELSTKQQQLYIGSTAGVAQLPLHRCDIYGKACAECCLARDPYCAWDGSSCSRYFPTAKRRTRR 555
            .:.:||.:..|.:.|...:..:|||.|. :...|..|...:||.||||..               
  Fly   485 ELVISTSKNSLVVVSDGSLVSVPLHHCS-HIVDCLGCLSLQDPICAWDLQ--------------- 533

  Rat   556 QDIRNGDPLTH-CSDLQHHDNHHGHSLEERIIYGVENSSTFLECSPKSQRALVYWQFQRRNEDRK 619
                     || |.:|....:..|             :.|:|               |..|..:|
  Fly   534 ---------THECKNLATSQHKFG-------------TKTYL---------------QSLNSTKK 561

  Rat   620 EEIRVGDHIIR-----------------TEQGLLLRSLQKKDSGNY--LCHAVEHGFMQTLLKVT 665
            ....:..||.|                 ||:..||.|......||.  |......|....|.|:|
  Fly   562 AAALLCPHIPRDAPGAETVSFVTMAPPPTEEQKLLYSNVGSSQGNQPSLEQQPTGGDDFGLNKIT 626

  Rat   666 LEVIDTEHLEELLHKDDDGDGSKTKEMSSSMTPS 699
            |..:|.:.:...|: |.....:...|:..:.|||
  Fly   627 LTSMDPDDIMPNLN-DPQKSTASVDEIKYASTPS 659

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema3aNP_059006.1 Sema_3A 26..518 CDD:200510 154/481 (32%)
PSI 516..>552 CDD:214655 9/35 (26%)
Ig_Sema3 580..671 CDD:409455 21/109 (19%)
Ig strand B 594..598 CDD:409455 2/3 (67%)
Ig strand C 606..610 CDD:409455 0/3 (0%)
Ig strand E 633..637 CDD:409455 0/3 (0%)
Ig strand F 647..652 CDD:409455 2/6 (33%)
Ig strand G 664..667 CDD:409455 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 677..698 3/20 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 729..772
Sema1bNP_001163178.1 Sema_1A 55..511 CDD:200498 154/479 (32%)
PSI 510..>537 CDD:214655 11/51 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3611
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11036
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.