DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema3a and Sema2a

DIOPT Version :9

Sequence 1:NP_059006.1 Gene:Sema3a / 29751 RGDID:3657 Length:772 Species:Rattus norvegicus
Sequence 2:NP_477507.1 Gene:Sema2a / 36846 FlyBaseID:FBgn0011260 Length:724 Species:Drosophila melanogaster


Alignment Length:654 Identity:215/654 - (32%)
Similarity:324/654 - (49%) Gaps:104/654 - (15%)


- Green bases have known domain annotations that are detailed below.


  Rat    42 SNNVITFNGLANSSSYHTFLLDEERSRLYVGAKDHIFSFNLVNI--KDFQKIVWPVSYTRRD--E 102
            :::|..||  .....|.||.::|:|..|||||.|.:|..||.||  .:..:.|..:..||.|  .
  Fly    55 ADHVREFN--CGKLYYRTFHMNEDRDTLYVGAMDRVFRVNLQNISSSNCNRDVINLEPTRDDVVS 117

  Rat   103 CKWAGKDILKECANFIKVLKAYNQ-THLYACGTGAFHPICTYIEVGHHPED-----NIFKLQDSH 161
            |...||..:.:|.|.::|:::.:| ..||.|||.|           |:|:|     |:..|..|.
  Fly   118 CVSKGKSQIFDCKNHVRVIQSMDQGDRLYVCGTNA-----------HNPKDYVIYANLTHLPRSE 171

  Rat   162 FENGRG----KSPYDPKLLTASLLIDG-------ELYSGTAADFMGRDFAIFRTLGHHHPI---- 211
            :..|.|    |.||||...:.::.::.       .|||||.|:|...|..||||..::...    
  Fly   172 YVIGVGLGIAKCPYDPLDNSTAIYVENGNPGGLPGLYSGTNAEFTKADTVIFRTDLYNTSAKRLE 236

  Rat   212 ----RTEQHDSRWLNDPRFISAHLIPESDNPEDDKVYFFFRENAIDGEHSGKATHARIGQICKND 272
                ||.::||:||:.|.|:.:..|.|       .|||||||.|::..:.|||.::||.::||.|
  Fly   237 YKFKRTLKYDSKWLDKPNFVGSFDIGE-------YVYFFFRETAVEYINCGKAVYSRIARVCKKD 294

  Rat   273 FGGHRSLVNKWTTFLKARLICSVPGPNGIDTHFDELQDVFLMNSKDPKNPIVYGVFTTSSNIFKG 337
            .||...|.:.|.|:|||||.||:.|.  ...:|:|:|.|:.:.|...:   .:..||||:|...|
  Fly   295 VGGKNLLAHNWATYLKARLNCSISGE--FPFYFNEIQSVYQLPSDKSR---FFATFTTSTNGLIG 354

  Rat   338 SAVCMYSMSDVRRVFLGPYAHRDGPNYQWVP-YQGRVPYPRPGTCPSKTFGGFDSTKDLPDDVIT 401
            ||||.:.:::::..|.|.:..:...|..|:| ...|||.||||||       .:.|.:|||.|:.
  Fly   355 SAVCSFHINEIQAAFNGKFKEQSSSNSAWLPVLNSRVPEPRPGTC-------VNDTSNLPDTVLN 412

  Rat   402 FARSHPAMYNPVFPINNRPIMIKTDVNYQFTQIVVD--RVDAEDGQYDVMFIGTDVGTVLKVVSV 464
            |.||||.|...|...:|.|:..|.|:  .||::|||  |:|..:.:|.|.::||::|.:.|:|. 
  Fly   413 FIRSHPLMDKAVNHEHNNPVYYKRDL--VFTKLVVDKIRIDILNQEYIVYYVGTNLGRIYKIVQ- 474

  Rat   465 PKETWHDLEEVLLEEMTVFR-EPT-TISAMELSTKQQQLYIGSTAGVAQLPLHRCDIYGKACAEC 527
                ::...|.|.:.:.:|. .|. .|..||:|..::.||||:...:.|:.|..|:.....|..|
  Fly   475 ----YYRNGESLSKLLDIFEVAPNEAIQVMEISQTRKSLYIGTDHRIKQIDLAMCNRRYDNCFRC 535

  Rat   528 CLARDPYCAWD--GSSCSRYFPTAKRRTRRQDIRNGDPLTHCSDLQHHDNHHGHSLEERII--YG 588
              .|||||.||  .::|..|     .....||:.|          :..|......|:::|:  ||
  Fly   536 --VRDPYCGWDKEANTCRPY-----ELDLLQDVAN----------ETSDICDSSVLKKKIVVTYG 583

  Rat   589 VENSSTFLECSPKSQRAL----VYWQFQRRNEDRKEEIRVG--DHIIRTEQGLLLRSLQKKDSGN 647
               .|..|.|..|....|    |.|....:::.| .|||..  .:|..||:||::.|:.:.|.|.
  Fly   584 ---QSVHLGCFVKIPEVLKNEQVTWYHHSKDKGR-YEIRYSPTKYIETTERGLVVVSVNEADGGR 644

  Rat   648 YLCH 651
            |.||
  Fly   645 YDCH 648

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema3aNP_059006.1 Sema_3A 26..518 CDD:200510 173/509 (34%)
PSI 516..>552 CDD:214655 12/37 (32%)
Ig_Sema3 580..671 CDD:409455 26/80 (33%)
Ig strand B 594..598 CDD:409455 1/3 (33%)
Ig strand C 606..610 CDD:409455 2/7 (29%)
Ig strand E 633..637 CDD:409455 2/3 (67%)
Ig strand F 647..652 CDD:409455 3/5 (60%)
Ig strand G 664..667 CDD:409455
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 677..698
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 729..772
Sema2aNP_477507.1 Sema_2A 66..523 CDD:200499 169/493 (34%)
Ig_Semaphorin_C 573..664 CDD:143180 26/80 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11361
eggNOG 1 0.900 - - E1_KOG3611
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31358
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D153798at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45857
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11036
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.920

Return to query results.
Submit another query.