DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema6c and Sema2a

DIOPT Version :9

Sequence 1:NP_059004.1 Gene:Sema6c / 29744 RGDID:3659 Length:960 Species:Rattus norvegicus
Sequence 2:NP_477507.1 Gene:Sema2a / 36846 FlyBaseID:FBgn0011260 Length:724 Species:Drosophila melanogaster


Alignment Length:587 Identity:190/587 - (32%)
Similarity:296/587 - (50%) Gaps:104/587 - (17%)


- Green bases have known domain annotations that are detailed below.


  Rat     9 PLL-LLLLLSLPQAQTAFPQDPI-------PLLTSDLQGTSPSSWFRGLEDDAVAAELGLDFQRF 65
            ||| |||||....::||...:..       |..|.:.||.  :::.:...|.......|..:.|.
  Fly     8 PLLALLLLLCSSVSETAADYENTWNFYYERPCCTGNDQGN--NNYGKHGADHVREFNCGKLYYRT 70

  Rat    66 LTLNR---TLLVAARDHVFSFDLQ------AQEEGEGLVPNKFLTWRSQDMENCAVRGK-LTDEC 120
            ..:|.   ||.|.|.|.||..:||      ...:...|.|.:      .|:.:|..:|| ...:|
  Fly    71 FHMNEDRDTLYVGAMDRVFRVNLQNISSSNCNRDVINLEPTR------DDVVSCVSKGKSQIFDC 129

  Rat   121 YNYIRVLVPWD-SQTLLACGTNSFSPVCRSY----GITSLQQEGEELS---GQARCPFDATQSTV 177
            .|::||:...| ...|..||||:.:|  :.|    .:|.|.:....:.   |.|:||:|...::.
  Fly   130 KNHVRVIQSMDQGDRLYVCGTNAHNP--KDYVIYANLTHLPRSEYVIGVGLGIAKCPYDPLDNST 192

  Rat   178 AISAEG-------SLYSATAADFQASDAVVYRSLGPQPPL-------------RSAKYDSKWLRE 222
            ||..|.       .|||.|.|:|..:|.|::|:     .|             |:.|||||||.:
  Fly   193 AIYVENGNPGGLPGLYSGTNAEFTKADTVIFRT-----DLYNTSAKRLEYKFKRTLKYDSKWLDK 252

  Rat   223 PHFVYALEHGDHVYFFFREVSVEDARLGRVQFSRVARVCKRDMGGSPRALDRHWTSFLKLRLNCS 287
            |:||.:.:.|::|||||||.:||....|:..:||:|||||:|:||. ..|..:|.::||.|||||
  Fly   253 PNFVGSFDIGEYVYFFFRETAVEYINCGKAVYSRIARVCKKDVGGK-NLLAHNWATYLKARLNCS 316

  Rat   288 VPGDSTFYFDVLQSLTG-PVNLHGRSALFGVFTTQTNSIPGSAVCAFYLDDIERGFEGKFKEQRS 351
            :.|:..|||:.:||:.. |.:   :|..|..|||.||.:.|||||:|::::|:..|.||||||.|
  Fly   317 ISGEFPFYFNEIQSVYQLPSD---KSRFFATFTTSTNGLIGSAVCSFHINEIQAAFNGKFKEQSS 378

  Rat   352 LDGAWTPVSEDKVPSPRPGSCAGVGAAALFSSSQDLPDDVLLFIKAHPLLDPAVPPATHQPL--- 413
            .:.||.||...:||.||||:|.        :.:.:|||.||.||::|||:|.||....:.|:   
  Fly   379 SNSAWLPVLNSRVPEPRPGTCV--------NDTSNLPDTVLNFIRSHPLMDKAVNHEHNNPVYYK 435

  Rat   414 --LTLTSRALLTQVAVDGMAGPHRNTTVLFLGSNDGTVLKVLP--PGGQSLGPEPIILEEIDAYS 474
              |..| :.::.::.:|.:   ::...|.::|:|.|.:.|::.  ..|:||.      :.:|.:.
  Fly   436 RDLVFT-KLVVDKIRIDIL---NQEYIVYYVGTNLGRIYKIVQYYRNGESLS------KLLDIFE 490

  Rat   475 HARCSGKRSPRAARRIIGLELDTEGHRLFVAFPGCIVYLSLSRC-ARHGACQRSCLASLDPYCGW 538
            .|       |..|.::  :|:......|::.....|..:.|:.| .|:..|.| |:.  ||||||
  Fly   491 VA-------PNEAIQV--MEISQTRKSLYIGTDHRIKQIDLAMCNRRYDNCFR-CVR--DPYCGW 543

  Rat   539 HR 540
            .:
  Fly   544 DK 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema6cNP_059004.1 Sema 52..516 CDD:417757 163/509 (32%)
PSI 517..>538 CDD:396154 9/21 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 555..624
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 685..725
PHA03307 730..>956 CDD:223039
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 745..792
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 806..960
Sema2aNP_477507.1 Sema_2A 66..523 CDD:200499 162/500 (32%)
Ig_Semaphorin_C 573..664 CDD:143180
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3611
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11036
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.