DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kcnj2 and Irk3

DIOPT Version :9

Sequence 1:NP_058992.1 Gene:Kcnj2 / 29712 RGDID:61968 Length:427 Species:Rattus norvegicus
Sequence 2:NP_001137835.2 Gene:Irk3 / 35131 FlyBaseID:FBgn0032706 Length:446 Species:Drosophila melanogaster


Alignment Length:352 Identity:111/352 - (31%)
Similarity:194/352 - (55%) Gaps:18/352 - (5%)


- Green bases have known domain annotations that are detailed below.


  Rat    22 ATMAVANGFGNG--KSKVHTRQQCRSRFVKKDGHCNVQFINVGEKGQRYLADIFTTCVDIRWRWM 84
            :|:.:....|:|  .|.....::..:|.::|:|..||.|..:.||..||:.|:.||.:::.|::|
  Fly    91 STIELTPDLGSGPRTSSSDGLRRSLNRVMEKNGKENVVFRRIPEKSWRYMRDLVTTLMELEWKYM 155

  Rat    85 LVIFCLAFVLSWLFFGCVFWLIALLHGDLDASKES--------KACVSEVNSFTAAFLFSIETQT 141
            |.:|..::.||||.|..:.:::|..|||......|        ..|:..|:|:.|..::|:||||
  Fly   156 LTLFLGSYFLSWLLFAALCYVVAYSHGDFIFDPVSGKRMGEGVDPCIYGVHSWVAMIIYSVETQT 220

  Rat   142 TIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVMAKMAKPKKRNETLVFSHNAVIAMRDG 206
            |:|:|.:..::|||..:|:.|.|.:...:|:..::..:.||.|:|.::...|.||..|||..|||
  Fly   221 TLGFGEKYASEECPETIFLFVMQMLSAALIEGCMVSVIYAKTARPARQLTKLKFSDKAVICYRDG 285

  Rat   207 KLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEGEYIPLDQIDINVGFDSGIDRIFLVSPITIVH 271
            :|||::||.:.|:...:|:.:|..::..:.|.|||.|. ..:::.:   .|.....::.|..:.|
  Fly   286 RLCLLFRVCDPREQQSIESKIRVYIIVDKRTREGETIK-SHVELKL---EGNGEQIILWPDVVCH 346

  Rat   272 EIDEDSPLYDLSKQDIDN-ADFEIVVILEGMVEATAMTTQCRSSYLANEILWGHRYEPVLF--EE 333
            .|||.|||...:...:.| |.||:.|.:.|...|||..|:.::|||..||.||.|:..::.  .:
  Fly   347 VIDETSPLSQFTTAKLFNAAQFELYVSIVGTSPATAQMTEAKTSYLPREIFWGQRFVNIIHYDAQ 411

  Rat   334 KHCYKVDYSRFHKTYEVPNTPLCSARD 360
            ...|.|||..|::|..| :.|:.:.::
  Fly   412 NERYIVDYENFNRTISV-DMPMTNPKN 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kcnj2NP_058992.1 IRK_N 1..47 CDD:400662 4/26 (15%)
IRK 48..186 CDD:395797 48/145 (33%)
Selectivity filter. /evidence=ECO:0000250 142..147 2/4 (50%)
IRK_C 193..366 CDD:407551 57/171 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..427
PDZ-binding. /evidence=ECO:0000255 425..427
Irk3NP_001137835.2 Ion_trans_2 119..432 CDD:304432 105/317 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.