DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psma7 and Prosalpha4

DIOPT Version :9

Sequence 1:NP_001008218.1 Gene:Psma7 / 29674 RGDID:61851 Length:248 Species:Rattus norvegicus
Sequence 2:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster


Alignment Length:245 Identity:170/245 - (69%)
Similarity:203/245 - (82%) Gaps:1/245 - (0%)


- Green bases have known domain annotations that are detailed below.


  Rat     3 YDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDD 67
            ||||:|:|||||||.|||||||||:||||||||||.:.|||||||||||:||::|.|||||.||:
  Fly     5 YDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKVRKICMLDN 69

  Rat    68 NVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISAL 132
            :|.||||||||||||:||||:||||||||.||||||:|||||:||.|||:|||||||||||||.|
  Fly    70 HVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGISCL 134

  Rat   133 IVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDDAIETDDLTIKLVIKALLE 197
            |.|||.||:..|:||:|||.::.:||||.||.||.||||.||:|.::.:..:...:||.|:||||
  Fly   135 IGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAIRALLE 199

  Rat   198 VVQSGGKNIELAVMRRDQPLKILSPEEIEKYVAEIEKEKEEN-EKKKQKK 246
            |.|||..|:|:|:|...:|||:|..:.|..||..|||||||. |||||||
  Fly   200 VAQSGQNNLEVAIMENGKPLKMLDTDVITDYVKIIEKEKEEELEKKKQKK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Psma7NP_001008218.1 PRK03996 1..230 CDD:235192 155/226 (69%)
proteasome_alpha_type_7 3..211 CDD:239724 148/207 (71%)
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 154/225 (68%)
proteasome_alpha_type_7 5..213 CDD:239724 148/207 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 273 1.000 Domainoid score I1718
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 346 1.000 Inparanoid score I2241
OMA 1 1.010 - - QHG62217
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 1 1.000 - - FOG0002043
OrthoInspector 1 1.000 - - mtm9055
orthoMCL 1 0.900 - - OOG6_101207
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1345
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.980

Return to query results.
Submit another query.