DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psma2 and Prosalpha4

DIOPT Version :9

Sequence 1:NP_058975.1 Gene:Psma2 / 29669 RGDID:61842 Length:234 Species:Rattus norvegicus
Sequence 2:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster


Alignment Length:237 Identity:85/237 - (35%)
Similarity:141/237 - (59%) Gaps:7/237 - (2%)


- Green bases have known domain annotations that are detailed below.


  Rat     1 MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKV 65
            |:.| |..::|.|||.|.|:|:|||..||..|:.:||::.||.|||..|||..:.|.::|.|.|:
  Fly     1 MSSR-YDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKVRKI 64

  Rat    66 EPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPF 130
            ..:..|:.:.::|:..|.|::::||:...|.:.|..::|:....:.:.:|.:.|:||||.|.|||
  Fly    65 CMLDNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPF 129

  Rat   131 GVSLLICGWN-EGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELED--AIHTAI 192
            |:|.||.|:: :|..:|||::|||.::.:||.|.|::....:.|.||.|.|:....:  |:..||
  Fly   130 GISCLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAI 194

  Rat   193 LTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEV-RDYLAAI 233
            ..|.|  ..|..::|:||.|.......::..|:| .||:..|
  Fly   195 RALLE--VAQSGQNNLEVAIMENGKPLKMLDTDVITDYVKII 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Psma2NP_058975.1 proteasome_alpha_type_2 6..231 CDD:239719 82/228 (36%)
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 81/227 (36%)
proteasome_alpha_type_7 5..213 CDD:239724 77/209 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.