DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Birc7 and Bruce

DIOPT Version :9

Sequence 1:NP_001292139.1 Gene:Birc7 / 296468 RGDID:1562883 Length:285 Species:Rattus norvegicus
Sequence 2:NP_001262460.1 Gene:Bruce / 41260 FlyBaseID:FBgn0266717 Length:4976 Species:Drosophila melanogaster


Alignment Length:118 Identity:35/118 - (29%)
Similarity:50/118 - (42%) Gaps:23/118 - (19%)


- Green bases have known domain annotations that are detailed below.


  Rat    90 MDSEDLRLASFYDWP--STAGIQPEPLAAAGFFH---TGQQDKVRCFFCYGGLQSWERGDDPWTE 149
            |.||.:|..:|..||  ......|:.:|.|||:|   :..:|:..||.|...|..||:.|:||:|
  Fly   245 MHSEAVRRQTFEKWPHMDYKWALPDQMAQAGFYHQPSSSGEDRAMCFTCSVCLVCWEKTDEPWSE 309

  Rat   150 HARWFPRCQFLLRSKGRDFVERIQAYTPLLGSWEQREEQEDTVSATPSAPTHG 202
            |.|..|.|.|                  :.|.:.|......|.:..|:.|..|
  Fly   310 HERHSPLCPF------------------VKGEYTQNVPLSITYATNPALPAPG 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Birc7NP_001292139.1 BIR 94..161 CDD:237989 26/71 (37%)
NTP-PPase 194..>236 CDD:302582 3/9 (33%)
zf-C3HC4_3 235..276 CDD:290631
BruceNP_001262460.1 BIR 251..321 CDD:279047 26/87 (30%)
DUF3643 3539..3664 CDD:289152
UQ_con 4636..4790 CDD:278603
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.