DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment F2rl2 and AstC-R1

DIOPT Version :9

Sequence 1:NP_445765.1 Gene:F2rl2 / 29636 RGDID:620871 Length:368 Species:Rattus norvegicus
Sequence 2:NP_649040.2 Gene:AstC-R1 / 40020 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster


Alignment Length:370 Identity:96/370 - (25%)
Similarity:162/370 - (43%) Gaps:67/370 - (18%)


- Green bases have known domain annotations that are detailed below.


  Rat    29 SDNSALTAESFNGNEHSFEEFPLSDIEGWTGATTTIKAKCPEESI--TTLHVNNATMGYLRSSLS 91
            :|:.|.....:|.|| |.....|:  ..|...::||:   ||||:  |.|......:. .|:|.:
  Fly    19 ADSEANATNWYNTNE-SLYTTELN--HRWISGSSTIQ---PEESLYGTDLPTYQHCIA-TRNSFA 76

  Rat    92 TKVIPAIYILVFVIGVPANIVTLW------KLSSRTKSICLVIFHTNLAIADLLFCVTLPFKIAY 150
            ......:|..|.:||:..|.:.::      |:.:.|.     |:..|||:||..|.:.:|| :.|
  Fly    77 DLFTVVLYGFVCIIGLFGNTLVIYVVLRFSKMQTVTN-----IYILNLAVADECFLIGIPF-LLY 135

  Rat   151 HLNGNDWVFGEVMCRVTTVAFYGNMYCAILILTCMGINRYLATVHPFT---YRKLPKRNFTLLMC 212
            .:....|.|||.||:...|:.....:.:.:.|..|..:||:|..||.:   ||.|   :...::.
  Fly   136 TMRICSWRFGEFMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTL---HIAKVVS 197

  Rat   213 GVVWVMVVLYMLPLAI----LKQEYHLVQPGIT-TCH----DVHDTCESPLPFQFYYFVSLAFFG 268
            .:.|....:.|||:.:    ::||     .||. :|:    |.:.. .|...|..|.|    |.|
  Fly   198 AIAWSTSAVLMLPVILYASTVEQE-----DGINYSCNIMWPDAYKK-HSGTTFILYTF----FLG 252

  Rat   269 FLIPFVVSVFCYTTLIHKLNA-----------QDRKWLRYIKAVLLILVIFTICFAP---TNIIL 319
            |..|....:..|..:|.||.:           :.|...:..:.||.::.::.:|:.|   :.:.|
  Fly   253 FATPLCFILSFYYLVIRKLRSVGPKPGTKSKEKRRAHRKVTRLVLTVISVYILCWLPHWISQVAL 317

  Rat   320 IIHHANYYYSNTDSLYFMYLIALCLGSL---NSCLDPFLYFIMSK 361
            |  |:|  .:..|......||.|.||:|   ||.::|.||..:|:
  Fly   318 I--HSN--PAQRDLSRLEILIFLLLGALVYSNSAVNPILYAFLSE 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
F2rl2NP_445765.1 7tm_1 128..356 CDD:278431 68/256 (27%)
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 76/294 (26%)
7tm_1 94..353 CDD:278431 71/281 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.