DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Angpt4 and CG31832

DIOPT Version :9

Sequence 1:NP_001099996.1 Gene:Angpt4 / 296269 RGDID:1307539 Length:508 Species:Rattus norvegicus
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:188 Identity:64/188 - (34%)
Similarity:97/188 - (51%) Gaps:6/188 - (3%)


- Green bases have known domain annotations that are detailed below.


  Rat   319 KPLKVFCDMETDGGGWTLIQRREDGSLNFQRTWEEYKEGFGNVAREHWLGNEAVHSLTSRTAYLL 383
            :|.:| ...:|....|.:||||.|||:||.::|..||:|||:...|.::|.:.::.:|....:.|
  Fly    42 EPFQV-TQCKTTARDWIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHEL 105

  Rat   384 RVELHDWEGHQTSIQYENFQLGSERQRYSLSVNDSSISARLKNSLAPQ-GTKFSTKDMDNDNCMC 447
            .::|....|......:::||:.||.:.|.|. .....|....:||... ..:|||.|.|||....
  Fly   106 FIQLKHGPGATVYAHFDDFQVDSETELYKLE-RVGKYSGTAGDSLRYHINKRFSTFDRDNDESSK 169

  Rat   448 KCAQMLSGGWWFDACGLSNLNGIYYPVHQHLHKINGIRWHYFRGPSYSLHGTRMMLRP 505
            .||....|||||.:|..|:|||:|:. ......:|||.|.  |....||...::|:||
  Fly   170 NCAAEHGGGWWFHSCLSSSLNGLYFR-EGETGMLNGIHWG--RWKFQSLTFVQIMIRP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Angpt4NP_001099996.1 FReD 291..506 CDD:238040 64/188 (34%)
CG31832NP_723894.2 FReD 28..225 CDD:238040 64/188 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.