DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pitx3 and otp

DIOPT Version :9

Sequence 1:NP_062120.1 Gene:Pitx3 / 29609 RGDID:3332 Length:302 Species:Rattus norvegicus
Sequence 2:NP_001286654.1 Gene:otp / 37364 FlyBaseID:FBgn0015524 Length:416 Species:Drosophila melanogaster


Alignment Length:291 Identity:84/291 - (28%)
Similarity:120/291 - (41%) Gaps:81/291 - (27%)


- Green bases have known domain annotations that are detailed below.


  Rat    59 KKKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERS 123
            |.||:|.||.||..||.|||..|.:..|||:..|||||:...|||:||:|||:||||||:||:::
  Fly   113 KNKQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKRKKT 177

  Rat   124 QQAELCKGGFAAPLGGLVPPYEEVYPGYTYGNWPPKALAPPLAAKTFPFAFN------------- 175
            ...      |..| |.|:|         ::|       .||..|.....|..             
  Fly   178 TNV------FRTP-GALLP---------SHG-------LPPFGANITNIAMGDGLCGTGMFGGDR 219

  Rat   176 -SVNVGPLAS---QPVFSPPSSIAASMVPSAAAAPGTVPGPGALQ--GLGGAPPGLAPAAV---S 231
             ||.|.|:.:   |...|.|.|.:.:...::....|:..|.|:.|  ||.    .|..:.:   |
  Fly   220 WSVGVNPMTAGFGQLNQSSPLSSSLNSGLNSGINMGSALGAGSYQHYGLN----ALGDSMMYQHS 280

  Rat   232 SGAVSC-PYASAAAA------AAAAASSPYVYRDPCNSSLASL-------------------RLK 270
            .|.||| |..|.:|.      :.::.:.|.:...| |||...|                   :.:
  Fly   281 VGGVSCGPSGSPSATTPPNMNSCSSVTPPPLSAQP-NSSQNELNGEPMPLHQQQQQQTHQHQQQQ 344

  Rat   271 AKQHASFSYPAVPGPPPAANLSPCQYAVERP 301
            ..||    :|..| |.|.........:::.|
  Fly   345 THQH----HPMAP-PTPTQQQQQLPQSMQSP 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pitx3NP_062120.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71 7/11 (64%)
Homeobox 66..119 CDD:395001 32/52 (62%)
PTZ00395 <142..>236 CDD:185594 23/115 (20%)
OAR 258..275 CDD:397759 6/35 (17%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 262..275 4/31 (13%)
Nuclear localization signal. /evidence=ECO:0000255 268..272 0/3 (0%)
otpNP_001286654.1 Homeobox 119..167 CDD:278475 26/47 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I4895
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.