DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arhgap11a and cv-c

DIOPT Version :9

Sequence 1:NP_001161996.1 Gene:Arhgap11a / 296060 RGDID:1309107 Length:994 Species:Rattus norvegicus
Sequence 2:NP_001097786.1 Gene:cv-c / 41749 FlyBaseID:FBgn0285955 Length:2351 Species:Drosophila melanogaster


Alignment Length:199 Identity:59/199 - (29%)
Similarity:90/199 - (45%) Gaps:39/199 - (19%)


- Green bases have known domain annotations that are detailed below.


  Rat    45 KIFGVPF--------NSLPHSVVPEYGHIPSFLVDACTSLKEHIHTEGLFRKSGSVIRLKALKSK 101
            |:||||.        .:||.:|...:..:....:|..          |:|||||...|:..|:.:
  Fly  1895 KVFGVPLLMILQRSGQTLPLAVRAAFRWLQLNALDQV----------GIFRKSGGKSRIMKLREQ 1949

  Rat   102 LDHGEACLSSALPC----------DVAGLLKQFFRELPEPVLPADLHE---ALFKAQQLGAEERN 153
            ::    ...|...|          |||.:|||:||||||.:|...:.|   |:|  |.|.||.|.
  Fly  1950 IE----VTDSTAECMDVFDLQQAYDVADMLKQYFRELPESLLTTKMSETFVAIF--QHLPAEVRL 2008

  Rat   154 KATLLLSCLMADPTVDVLRYFFNFLKSVSLRASENKMDSSNLAVIFAPNLLQT--SEGHEKMSAN 216
            .|......|:.|...::|.....||..|:..:.:|:|.|:||.|..|.::..:  |.|...:||:
  Fly  2009 DAVQCAVLLLPDENREILYVLLEFLTIVAANSQQNQMTSNNLGVCLAQSIFHSSISTGSASVSAS 2073

  Rat   217 TEKK 220
            ..:|
  Fly  2074 PRRK 2077

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arhgap11aNP_001161996.1 RhoGAP-ARHGAP11A 46..246 CDD:239859 58/198 (29%)
cv-cNP_001097786.1 SAM_DLC1,2-like 1382..1441 CDD:188937
RhoGAP_DLC1 1893..2116 CDD:239840 59/199 (30%)
SRPBCC 2148..2343 CDD:301327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.