DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hes1 and cwo

DIOPT Version :9

Sequence 1:NP_077336.3 Gene:Hes1 / 29577 RGDID:62081 Length:281 Species:Rattus norvegicus
Sequence 2:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster


Alignment Length:330 Identity:76/330 - (23%)
Similarity:111/330 - (33%) Gaps:120/330 - (36%)


- Green bases have known domain annotations that are detailed below.


  Rat    16 ATPASVNTTPDKPKTASEHRKSSKP------IMEKRRRARINESLSQLKTLILDALKKDSSRHSK 74
            :|.|:..:..|.........|:|:.      |:|||||.|:|..|:.|..||....::..  ..:
  Fly    38 STSATAYSEDDAEYATGRRNKTSRQDPLSHRIIEKRRRDRMNSCLADLSRLIPPQYQRKG--RGR 100

  Rat    75 LEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFL------STCEGVNT 133
            :||.:|:||.::||::||        |........||:|:.:||.|..:||      ..|.    
  Fly   101 IEKTEIIEMAIRHLKHLQ--------SECQQKESDYRSGYMDCMKEAAKFLYDVHMQDFCH---- 153

  Rat   134 EVRTRLLGHL----------------ANCMTQINAMTYPGQAHPALQAPPPP-------PPSGPG 175
                ||||.|                .:|....|.....|..|   ||..||       ..:...
  Fly   154 ----RLLGRLQEHIDEMFKTDCYKSTRSCHMPDNVSASSGSPH---QAYHPPLCHLRDMLATSAS 211

  Rat   176 GPQH--------------------------APFAPPPPLVPIPGGAAPPPGSAPCKLGSQAGEAA 214
            ..:|                          |..|.....|.:..|::|         .|.||..:
  Fly   212 DVEHSQDHNDVKDLSFRNHLNQLQRSQQAAAAAAVAAAAVAVANGSSP---------ASNAGVDS 267

  Rat   215 KV-------FGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTS---VGPNAVSPSSGSS 269
            ||       .||  ..||.|.                 :|..::.||::   .|.|:.|..|.||
  Fly   268 KVPLTNGGGTGG--APPAADN-----------------VPSNSTGSGSAAACAGGNSNSSGSNSS 313

  Rat   270 LTADS 274
            ..|.|
  Fly   314 NAASS 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hes1NP_077336.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 6/33 (18%)
bHLH-O_HES1_4 33..95 CDD:381465 23/67 (34%)
Hairy_orange 110..148 CDD:400076 15/59 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..206 11/80 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..281 8/23 (35%)
WRPW motif 276..279
cwoNP_524775.1 HLH 66..118 CDD:306515 19/53 (36%)
ORANGE 126..168 CDD:128787 14/49 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334638
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.