DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hes1 and E(spl)m5-HLH

DIOPT Version :9

Sequence 1:NP_077336.3 Gene:Hes1 / 29577 RGDID:62081 Length:281 Species:Rattus norvegicus
Sequence 2:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster


Alignment Length:262 Identity:55/262 - (20%)
Similarity:98/262 - (37%) Gaps:86/262 - (32%)


- Green bases have known domain annotations that are detailed below.


  Rat    18 PASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILE 82
            |.|.|:|....|| ..:.|..||::|::||||:|:.|..||||:.:....|:.  .:::||::||
  Fly     3 PQSNNSTTFVSKT-QHYLKVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDAI--LRMDKAEMLE 64

  Rat    83 MTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCM 147
            ..:..:|. |..:..|.:|  |..:..::.|:...::|::|.::....::.:|...::.||.   
  Fly    65 AALVFMRK-QVVKQQAPVS--PLPMDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHLG--- 123

  Rat   148 TQINAMTYPGQAHPALQAPPPPPPSGPGGPQHAPFAPPPPLVPIPGGAAPPPGSAPCKLGSQAGE 212
            .:...|....|...::....|.|.|                                        
  Fly   124 VEFQRMLQADQVQTSVTTSTPRPLS---------------------------------------- 148

  Rat   213 AAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGSSLTADSMWR 277
                       ||..|                    |.|::..|  .:|.||..    ..::|||
  Fly   149 -----------PASSG--------------------YHSDNEDS--QSAASPKP----VEETMWR 176

  Rat   278 PW 279
            ||
  Fly   177 PW 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hes1NP_077336.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 9/25 (36%)
bHLH-O_HES1_4 33..95 CDD:381465 21/61 (34%)
Hairy_orange 110..148 CDD:400076 6/37 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..206 4/47 (9%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..281 9/25 (36%)
WRPW motif 276..279 2/2 (100%)
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 19/53 (36%)
ORANGE 87..131 CDD:128787 7/46 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334581
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.