DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hes1 and E(spl)m3-HLH

DIOPT Version :9

Sequence 1:NP_077336.3 Gene:Hes1 / 29577 RGDID:62081 Length:281 Species:Rattus norvegicus
Sequence 2:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster


Alignment Length:261 Identity:68/261 - (26%)
Similarity:110/261 - (42%) Gaps:60/261 - (22%)


- Green bases have known domain annotations that are detailed below.


  Rat    33 EHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNL-QRAQM 96
            ::||..||::|::||||||:.|..||.|:::.|:::....::||||||||:||.|:|.| ||..:
  Fly    10 QYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQRGGL 74

  Rat    97 ----------TAALSTDPSVLGKYRAGFSECMNEVTRFL---STCEGVNTEVRTRLLGHLANCMT 148
                      :...||..:.:..:|:|:....:::|:.|   ...:.:..::...|...|....|
  Fly    75 SLQGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQQTDEIGRKIMKFLSTRLIELQT 139

  Rat   149 QINAMTYPGQAHPALQAPPPPPPSGPGGPQHAPFAPPPPLVPIPGGAAPPPGSAPCKLGSQAGEA 213
            |:.......|.|...|.   |..||     ...|       |:.||..|...:|           
  Fly   140 QLLQQQQQQQQHQQQQI---PQSSG-----RLAF-------PLLGGYGPAAAAA----------- 178

  Rat   214 AKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGSSLTADSMWRP 278
                               .|...:|..|...:...||..|.::...| |.||..|..::.:|||
  Fly   179 -------------------AISYSSFLTSKDELIDVTSVDGNALSETA-SVSSQESGASEPVWRP 223

  Rat   279 W 279
            |
  Fly   224 W 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hes1NP_077336.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 4/10 (40%)
bHLH-O_HES1_4 33..95 CDD:381465 31/62 (50%)
Hairy_orange 110..148 CDD:400076 6/40 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..206 12/47 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..281 9/25 (36%)
WRPW motif 276..279 2/2 (100%)
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 29/58 (50%)
ORANGE 96..136 CDD:128787 6/39 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334580
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.