DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hes1 and E(spl)mbeta-HLH

DIOPT Version :9

Sequence 1:NP_077336.3 Gene:Hes1 / 29577 RGDID:62081 Length:281 Species:Rattus norvegicus
Sequence 2:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster


Alignment Length:259 Identity:72/259 - (27%)
Similarity:110/259 - (42%) Gaps:87/259 - (33%)


- Green bases have known domain annotations that are detailed below.


  Rat    33 EHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMT 97
            ::||..||::|::||||||:.|.:||.::::.|.::....::||||||||:||:|::.| |||..
  Fly    12 QYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKL-RAQKQ 75

  Rat    98 AALST---------DP--SVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQIN 151
            ..||:         ||  |:...:|||:....|||::.|:...||:.::.|:|:.||.:.:..:.
  Fly    76 LRLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLGHRLNYLQ 140

  Rat   152 AMTYPGQAHPALQAPPPPPPSGP-GGPQHAPFAPPPPLVPIPGGAAPPPGSAPCKLGSQAGEAAK 215
            .:.                ||.| |.|..||       |.......|||.....           
  Fly   141 VVV----------------PSLPIGVPLQAP-------VEDQAMVTPPPSECDS----------- 171

  Rat   216 VFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGSSLTADSMWRPW 279
                                    ..||...|               :||..|| |:..|||||
  Fly   172 ------------------------LESGACSP---------------APSEASS-TSGPMWRPW 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hes1NP_077336.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 4/10 (40%)
bHLH-O_HES1_4 33..95 CDD:381465 28/61 (46%)
Hairy_orange 110..148 CDD:400076 13/37 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..206 11/48 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..281 10/25 (40%)
WRPW motif 276..279 2/2 (100%)
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 30/62 (48%)
ORANGE 97..141 CDD:128787 13/43 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334579
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.