DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GTF2A1 and TfIIA-L

DIOPT Version :9

Sequence 1:NP_056943.1 Gene:GTF2A1 / 2957 HGNCID:4646 Length:376 Species:Homo sapiens
Sequence 2:NP_476995.1 Gene:TfIIA-L / 43284 FlyBaseID:FBgn0011289 Length:366 Species:Drosophila melanogaster


Alignment Length:407 Identity:144/407 - (35%)
Similarity:210/407 - (51%) Gaps:86/407 - (21%)


- Green bases have known domain annotations that are detailed below.


Human     9 TVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAV-------DGFHSEEQQL 66
            :|.|:|.:||||||.:|||.|||:|||||||.|:|.:|.|||:.|:||       ||.|      
  Fly     7 SVLKVYHAVIEDVITNVRDAFLDEGVDEQVLQEMKQVWRNKLLASKAVELSPDSGDGSH------ 65

Human    67 LLQVQQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNA 131
                                     |...|....::.:.....:::|.|...:.....:..:.:.
  Fly    66 -------------------------PPPIVANNPKSHKAANAKAKKAAAATAVTSHQHIGGNSSM 105

Human   132 SNM----SAAATAATLALPAGVTPV-QQILTNSGQLLQVVRAANGAQYIFQPQQSVVLQQQ---- 187
            |::    |:|..||...:..|:.|: |::.:.:...|....||:    :.|.||......|    
  Fly   106 SSLVGLKSSAGMAAGSGIRNGLVPIKQEVNSQNPPPLHPTSAAS----MMQKQQQAASSGQGSIP 166

Human   188 VIPQMQPGGVQAPVIQQVLAPLP-GGISPQTGVI-IQ-PQQILFTGNKTQV-----------IPT 238
            ::..:.|..:. ||  .:..|.| |..|.::.|: || |...|.....||:           :||
  Fly   167 IVATLDPNRIM-PV--NITLPSPAGSASSESRVLTIQVPASALQENQLTQILTAHLISSIMSLPT 228

Human   239 TVAAPTPAQ---AQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEED--YDDDEEED 298
            |:|:....|   |.:::...|:..|        ...|:||..| ||:|||.||.|  .|:|:::|
  Fly   229 TLASSVLQQHVNAALSSANHQKTLA--------AAKQLDGALD-SSDEDESEESDDNIDNDDDDD 284

Human   299 KEKDGAEDGQ----VEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMN 359
            .:||..||.:    .|||||||||||:||:..|:|||:||:|||||||.||:|||||:|||||||
  Fly   285 LDKDDDEDAEHEDAAEEEPLNSEDDVTDEDSAEMFDTDNVIVCQYDKITRSRNKWKFYLKDGIMN 349

Human   360 LNGRDYIFSKAIGDAEW 376
            :.|:||:|.|:.|||||
  Fly   350 MRGKDYVFQKSNGDAEW 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GTF2A1NP_056943.1 TFIIA 13..376 CDD:397322 140/401 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 69..107 2/37 (5%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 247..266 4/21 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 274..329 32/60 (53%)
TfIIA-LNP_476995.1 TFIIA_alpha_beta_like 8..>62 CDD:199899 31/53 (58%)
TFIIA 11..366 CDD:281188 140/401 (35%)
TFIIA_alpha_beta_like <306..366 CDD:199899 42/59 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141873
Domainoid 1 1.000 144 1.000 Domainoid score I4618
eggNOG 1 0.900 - - E1_KOG2652
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I3786
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1443035at2759
OrthoFinder 1 1.000 - - FOG0002746
OrthoInspector 1 1.000 - - otm41527
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12694
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1533
SonicParanoid 1 1.000 - - X1433
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.980

Return to query results.
Submit another query.