DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Map2k5 and lic

DIOPT Version :9

Sequence 1:XP_038936881.1 Gene:Map2k5 / 29568 RGDID:61890 Length:487 Species:Rattus norvegicus
Sequence 2:NP_477162.1 Gene:lic / 32257 FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster


Alignment Length:270 Identity:114/270 - (42%)
Similarity:153/270 - (56%) Gaps:31/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Rat   172 LGHGNGGTVYKAYHVPSGKILAVKVILLDITLELQKQIMSELEI-LYKCDSSYIIGFYGAFFVEN 235
            ||.|..|.|.|..|..:..:||||.|.:.:.:..|.:::.:|:| :...|..|.:.||||.:.|.
  Fly    52 LGRGAYGIVDKMRHKQTDTVLAVKRIPMTVNIREQHRLVMDLDISMRSSDCPYTVHFYGAMYREG 116

  Rat   236 RISICTEFMDGGSLD-VYRKI-------PEHVLGRIAVAVVKGLTYLWS-LKILHRDVKPSNMLV 291
            .:.||.|.| ..||| .|.|:       .|.|||:||::||..|.||.: ||::||||||||:|:
  Fly   117 DVWICMEVM-STSLDKFYPKVFLHDLRMEESVLGKIAMSVVSALHYLHAQLKVIHRDVKPSNILI 180

  Rat   292 NTSGQVKLCDFGVSTQLVNSIAKTY-VGTNAYMAPERISGE----QYGIHSDVWSLGISFMELAL 351
            |.:||||:||||:|..||:|||||. .|...|||||||..:    ||.|.||||||||..:|:|.
  Fly   181 NRAGQVKICDFGISGYLVDSIAKTIDAGCKPYMAPERIDPQGNPAQYDIRSDVWSLGIGMIEMAT 245

  Rat   352 GRFPYPQIQKNQGSLMPLQLLQCIVDEDSPVLPLGEFSEPFVHFITQWNRAGLCRTAHWSLETRP 416
            ||:||...:      .|.:.|:.:|::..|.||.|.||..|..||      .:|....:.  .||
  Fly   246 GRYPYDNWR------TPFEQLRQVVEDSPPRLPEGTFSPEFEDFI------AVCLQKEYM--ARP 296

  Rat   417 -YRFTLKKPF 425
             |...||..|
  Fly   297 NYEQLLKHSF 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Map2k5XP_038936881.1 PB1_Map2k5 17..107 CDD:99717
PKc_like 164..401 CDD:419665 107/243 (44%)
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 114/270 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D688282at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.