DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hes2 and E(spl)m5-HLH

DIOPT Version :9

Sequence 1:NP_062109.1 Gene:Hes2 / 29567 RGDID:62082 Length:157 Species:Rattus norvegicus
Sequence 2:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster


Alignment Length:165 Identity:50/165 - (30%)
Similarity:84/165 - (50%) Gaps:28/165 - (16%)


- Green bases have known domain annotations that are detailed below.


  Rat    15 KSLKPLLEKRRRARINESLSQLKGLVLPLLGAETSRYSKLEKADILEMTVRFLREQPASVCSTEA 79
            |..|||||::||||:|:.|..||.||....|.:.  ..:::||::||..:.|:|:|.....:..:
  Fly    20 KVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDA--ILRMDKAEMLEAALVFMRKQVVKQQAPVS 82

  Rat    80 PGSLDSYLEGYRACLARLARVLPACSVLEPAVSA---------------RLL--EHLRQRTVSGG 127
            |..:||:..||...::.::||: ||:   ||:|.               |:|  :.::....:..
  Fly    83 PLPMDSFKNGYMNAVSEISRVM-ACT---PAMSVDVGKTVMTHLGVEFQRMLQADQVQTSVTTST 143

  Rat   128 PPSLTPASA-----SAPAPSPPVPPPSSLGLWRPW 157
            |..|:|||:     :..:.|...|.|....:||||
  Fly   144 PRPLSPASSGYHSDNEDSQSAASPKPVEETMWRPW 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hes2NP_062109.1 HLH 12..69 CDD:238036 22/53 (42%)
ORANGE 84..128 CDD:128787 13/60 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..157 10/37 (27%)
WRPW motif 154..157 2/2 (100%)
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 22/53 (42%)
ORANGE 87..131 CDD:128787 12/47 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334597
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47782
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.