DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hes2 and E(spl)mbeta-HLH

DIOPT Version :9

Sequence 1:NP_062109.1 Gene:Hes2 / 29567 RGDID:62082 Length:157 Species:Rattus norvegicus
Sequence 2:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster


Alignment Length:184 Identity:53/184 - (28%)
Similarity:83/184 - (45%) Gaps:38/184 - (20%)


- Green bases have known domain annotations that are detailed below.


  Rat    12 ELRKSLKPLLEKRRRARINESLSQLKGLVLPLLGAETSRYSKLEKADILEMTVRFLREQPA---- 72
            :.||.:||:||::||||||:.|.:||.:::..|..|....::||||||||:||..:::..|    
  Fly    12 QYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKLRAQKQL 76

  Rat    73 ---SVCSTEAPGS------LDSYLEGYRACLARLARVLPACSVLEPAVSARLLEHLRQR------ 122
               ||....:|.:      .:|:..||......:::.|.|...:...:..:|:.||..|      
  Fly    77 RLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLGHRLNYLQV 141

  Rat   123 ---TVSGGPPSLTPASASAPAPSPP-----------VPPPSSLG-----LWRPW 157
               ::..|.|...|....|....||           .|.||...     :||||
  Fly   142 VVPSLPIGVPLQAPVEDQAMVTPPPSECDSLESGACSPAPSEASSTSGPMWRPW 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hes2NP_062109.1 HLH 12..69 CDD:238036 27/56 (48%)
ORANGE 84..128 CDD:128787 9/52 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..157 11/48 (23%)
WRPW motif 154..157 2/2 (100%)
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 28/61 (46%)
ORANGE 97..141 CDD:128787 9/43 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334595
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47782
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.