DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hes2 and dpn

DIOPT Version :9

Sequence 1:NP_062109.1 Gene:Hes2 / 29567 RGDID:62082 Length:157 Species:Rattus norvegicus
Sequence 2:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster


Alignment Length:164 Identity:60/164 - (36%)
Similarity:85/164 - (51%) Gaps:22/164 - (13%)


- Green bases have known domain annotations that are detailed below.


  Rat     1 MRLPRGVGDAAELRKSLKPLLEKRRRARINESLSQLKGLVLPLLGAETSRYSKLEKADILEMTVR 65
            |..|.|: ..|||||:.||::|||||||||..|::||.|:|..:..:.:|::||||||||||||:
  Fly    29 MSNPNGL-SKAELRKTNKPIMEKRRRARINHCLNELKSLILEAMKKDPARHTKLEKADILEMTVK 92

  Rat    66 FL---REQPASVCSTEAPGSLDSYLEGYRACLARLARVLPACSVLEPAVSARLLEHLRQRTVS-- 125
            .|   :.|..::.....|..:..:..|:..|...:.|.:.....::..|..||..||.|...|  
  Fly    93 HLQSVQRQQLNMAIQSDPSVVQKFKTGFVECAEEVNRYVSQMDGIDTGVRQRLSAHLNQCANSLE 157

  Rat   126 -------------GGPPSLTPASASAPAPSPPVP 146
                         ||   |.||:|...||:|..|
  Fly   158 QIGSMSNFSNGYRGG---LFPATAVTAAPTPLFP 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hes2NP_062109.1 HLH 12..69 CDD:238036 34/59 (58%)
ORANGE 84..128 CDD:128787 11/58 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..157 11/38 (29%)
WRPW motif 154..157
dpnNP_476923.1 HLH 39..101 CDD:238036 34/61 (56%)
ORANGE 114..158 CDD:128787 10/43 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1427802at2759
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.