Sequence 1: | XP_038944182.1 | Gene: | Lsamp / 29561 | RGDID: | 71102 | Length: | 378 | Species: | Rattus norvegicus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
Alignment Length: | 333 | Identity: | 99/333 - (29%) |
---|---|---|---|
Similarity: | 146/333 - (43%) | Gaps: | 49/333 - (14%) |
- Green bases have known domain annotations that are detailed below.
Rat 51 FNRGTDNITVRQGDTAILRCVVEDKNS-KVAW--LNRSGIIFAGHDKWSLDPRVELEKRHALEYS 112
Rat 113 -----LRIQKVDVYDEGSYTCSVQTQHEPKTSQV-YLIVQVPPKISNIS---SDVTVNEGSNVTL 168
Rat 169 VCMANGRPEPVITWRHLTPLGREFEGEE--------------EYLEILGITREQSGKYECKAANE 219
Rat 220 VSSADVKQVKVTVNYPPTI-TESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEI 283
Rat 284 KSTE----GQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFKRVLPTVPHPIQEIGTTVHFK 344
Rat 345 QKG--PGS 350 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lsamp | XP_038944182.1 | Ig | 55..145 | CDD:416386 | 33/98 (34%) |
FR1 | 55..71 | CDD:409353 | 6/15 (40%) | ||
Ig strand A' | 56..62 | CDD:409353 | 3/5 (60%) | ||
Ig strand B | 64..72 | CDD:409353 | 3/7 (43%) | ||
CDR1 | 72..76 | CDD:409353 | 2/3 (67%) | ||
FR2 | 77..84 | CDD:409353 | 4/9 (44%) | ||
Ig strand C | 77..83 | CDD:409353 | 4/8 (50%) | ||
CDR2 | 85..95 | CDD:409353 | 1/9 (11%) | ||
Ig strand C' | 87..90 | CDD:409353 | 1/2 (50%) | ||
Ig strand C' | 92..95 | CDD:409353 | 0/2 (0%) | ||
FR3 | 96..131 | CDD:409353 | 9/39 (23%) | ||
Ig strand D | 100..107 | CDD:409353 | 0/6 (0%) | ||
Ig strand E | 110..116 | CDD:409353 | 2/10 (20%) | ||
Ig strand F | 123..131 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 132..136 | CDD:409353 | 1/3 (33%) | ||
Ig strand G | 136..145 | CDD:409353 | 6/9 (67%) | ||
FR4 | 138..145 | CDD:409353 | 5/7 (71%) | ||
Ig_3 | 148..218 | CDD:404760 | 28/86 (33%) | ||
Ig strand A' | 155..160 | CDD:409353 | 2/7 (29%) | ||
Ig strand B | 166..173 | CDD:409353 | 1/6 (17%) | ||
Ig strand C | 179..184 | CDD:409353 | 2/4 (50%) | ||
Ig strand D | 190..193 | CDD:409353 | 2/2 (100%) | ||
Ig strand E | 197..203 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 210..217 | CDD:409353 | 3/6 (50%) | ||
Ig strand G | 224..232 | CDD:409353 | 1/7 (14%) | ||
Ig_3 | 235..311 | CDD:404760 | 17/80 (21%) | ||
Ig strand B | 252..256 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 265..269 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 290..294 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 304..309 | CDD:409353 | 3/4 (75%) | ||
Ig strand G | 318..321 | CDD:409353 | 1/2 (50%) | ||
DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | 34/99 (34%) |
Ig | 145..238 | CDD:416386 | 30/99 (30%) | ||
Ig strand A | 145..149 | CDD:409353 | 2/3 (67%) | ||
Ig strand A' | 154..159 | CDD:409353 | 2/4 (50%) | ||
Ig strand B | 165..172 | CDD:409353 | 1/6 (17%) | ||
Ig strand C | 178..183 | CDD:409353 | 3/10 (30%) | ||
Ig strand C' | 185..187 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 195..199 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 203..209 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 216..223 | CDD:409353 | 3/6 (50%) | ||
Ig strand G | 230..238 | CDD:409353 | 1/7 (14%) | ||
Ig | 242..333 | CDD:416386 | 22/90 (24%) | ||
Ig strand A' | 250..253 | CDD:409353 | 0/2 (0%) | ||
Ig strand B | 259..266 | CDD:409353 | 1/6 (17%) | ||
Ig strand C | 272..277 | CDD:409353 | 1/4 (25%) | ||
Ig strand C' | 281..283 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 289..293 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 295..305 | CDD:409353 | 1/9 (11%) | ||
Ig strand F | 314..322 | CDD:409353 | 4/7 (57%) | ||
Ig strand G | 325..334 | CDD:409353 | 3/8 (38%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 45 | 1.000 | Domainoid score | I11853 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 142 | 1.000 | Inparanoid score | I4382 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D265311at33208 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000150 | |
OrthoInspector | 1 | 1.000 | - | - | mtm8971 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 1 | 1.000 | - | - | X97 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
9 | 8.870 |