DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lsamp and DIP-delta

DIOPT Version :9

Sequence 1:XP_038944182.1 Gene:Lsamp / 29561 RGDID:71102 Length:378 Species:Rattus norvegicus
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:333 Identity:99/333 - (29%)
Similarity:146/333 - (43%) Gaps:49/333 - (14%)


- Green bases have known domain annotations that are detailed below.


  Rat    51 FNRGTDNITVRQGDTAILRCVVEDKNS-KVAW--LNRSGIIFAGHDKWSLDPRVELEKRHALEYS 112
            |.:...|:||..|..|.|.||||.... ||||  ::|..|:.......|..|      |:::.|:
  Fly    46 FAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIP------RYSITYT 104

  Rat   113 -----LRIQKVDVYDEGSYTCSVQTQHEPKTSQV-YLIVQVPPKISNIS---SDVTVNEGSNVTL 168
                 |.:.:....|.|.|.|.|.|  .|..||| ||.|.|||.|.:|.   |.|.|.|..|:.:
  Fly   105 DNTWLLHVNQAHQDDRGYYMCQVNT--NPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINM 167

  Rat   169 VCMANGRPEPVITWRHLTPLGREFEGEE--------------EYLEILGITREQSGKYECKAANE 219
            .|.|:|.|.|.|.||      || :|||              :.|.:..::|.:.|.|.|.|.|.
  Fly   168 TCRADGFPAPKIIWR------RE-DGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNG 225

  Rat   220 VSSADVKQVKVTVNYPPTI-TESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEI 283
            |..:..|::.:.|.:.|.| ..::...|.:|...::.|...|.|.....|..:...:..:...:.
  Fly   226 VPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPSKKYKT 290

  Rat   284 KSTE----GQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFKRVLPTVPHPIQEIGTTVHFK 344
            ..||    ....||:.|:....:|||.|::.|.||.|..|:.:::..||:.|.. |...|||..:
  Fly   291 DYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPSTPSK-QVTHTTVESR 354

  Rat   345 QKG--PGS 350
            :..  |.|
  Fly   355 ENNIIPSS 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LsampXP_038944182.1 Ig 55..145 CDD:416386 33/98 (34%)
FR1 55..71 CDD:409353 6/15 (40%)
Ig strand A' 56..62 CDD:409353 3/5 (60%)
Ig strand B 64..72 CDD:409353 3/7 (43%)
CDR1 72..76 CDD:409353 2/3 (67%)
FR2 77..84 CDD:409353 4/9 (44%)
Ig strand C 77..83 CDD:409353 4/8 (50%)
CDR2 85..95 CDD:409353 1/9 (11%)
Ig strand C' 87..90 CDD:409353 1/2 (50%)
Ig strand C' 92..95 CDD:409353 0/2 (0%)
FR3 96..131 CDD:409353 9/39 (23%)
Ig strand D 100..107 CDD:409353 0/6 (0%)
Ig strand E 110..116 CDD:409353 2/10 (20%)
Ig strand F 123..131 CDD:409353 3/7 (43%)
CDR3 132..136 CDD:409353 1/3 (33%)
Ig strand G 136..145 CDD:409353 6/9 (67%)
FR4 138..145 CDD:409353 5/7 (71%)
Ig_3 148..218 CDD:404760 28/86 (33%)
Ig strand A' 155..160 CDD:409353 2/7 (29%)
Ig strand B 166..173 CDD:409353 1/6 (17%)
Ig strand C 179..184 CDD:409353 2/4 (50%)
Ig strand D 190..193 CDD:409353 2/2 (100%)
Ig strand E 197..203 CDD:409353 1/5 (20%)
Ig strand F 210..217 CDD:409353 3/6 (50%)
Ig strand G 224..232 CDD:409353 1/7 (14%)
Ig_3 235..311 CDD:404760 17/80 (21%)
Ig strand B 252..256 CDD:409353 0/3 (0%)
Ig strand C 265..269 CDD:409353 0/3 (0%)
Ig strand E 290..294 CDD:409353 1/3 (33%)
Ig strand F 304..309 CDD:409353 3/4 (75%)
Ig strand G 318..321 CDD:409353 1/2 (50%)
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 34/99 (34%)
Ig 145..238 CDD:416386 30/99 (30%)
Ig strand A 145..149 CDD:409353 2/3 (67%)
Ig strand A' 154..159 CDD:409353 2/4 (50%)
Ig strand B 165..172 CDD:409353 1/6 (17%)
Ig strand C 178..183 CDD:409353 3/10 (30%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 1/7 (14%)
Ig 242..333 CDD:416386 22/90 (24%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 1/6 (17%)
Ig strand C 272..277 CDD:409353 1/4 (25%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 1/9 (11%)
Ig strand F 314..322 CDD:409353 4/7 (57%)
Ig strand G 325..334 CDD:409353 3/8 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I11853
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4382
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8971
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.