| Sequence 1: | XP_038944182.1 | Gene: | Lsamp / 29561 | RGDID: | 71102 | Length: | 378 | Species: | Rattus norvegicus |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_731114.2 | Gene: | Ama / 40831 | FlyBaseID: | FBgn0000071 | Length: | 341 | Species: | Drosophila melanogaster |
| Alignment Length: | 300 | Identity: | 92/300 - (30%) |
|---|---|---|---|
| Similarity: | 136/300 - (45%) | Gaps: | 27/300 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Rat 57 NITVRQGDTAILRCVVEDKNS-KVAWLNR------SGIIFAGHDKWSL-DPR-----VELEKRHA 108
Rat 109 LEYSLRIQKVDVYDEGSYTCSVQTQHEPK-TSQVYLIVQVPPKIS-NISSDVTVNEGSNVTLVCM 171
Rat 172 ANGRPEPVITWRH----LTPLGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTV 232
Rat 233 NYPPTITESKSNEA-TTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLT--- 293
Rat 294 --VTNVTEEHYGNYTCVAANKLGVTNASLVLFKRVLPTVP 331 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lsamp | XP_038944182.1 | Ig | 55..145 | CDD:416386 | 27/101 (27%) |
| FR1 | 55..71 | CDD:409353 | 2/13 (15%) | ||
| Ig strand A' | 56..62 | CDD:409353 | 0/4 (0%) | ||
| Ig strand B | 64..72 | CDD:409353 | 2/7 (29%) | ||
| CDR1 | 72..76 | CDD:409353 | 2/3 (67%) | ||
| FR2 | 77..84 | CDD:409353 | 2/7 (29%) | ||
| Ig strand C | 77..83 | CDD:409353 | 2/6 (33%) | ||
| CDR2 | 85..95 | CDD:409353 | 0/9 (0%) | ||
| Ig strand C' | 87..90 | CDD:409353 | 0/2 (0%) | ||
| Ig strand C' | 92..95 | CDD:409353 | 0/2 (0%) | ||
| FR3 | 96..131 | CDD:409353 | 15/40 (38%) | ||
| Ig strand D | 100..107 | CDD:409353 | 3/11 (27%) | ||
| Ig strand E | 110..116 | CDD:409353 | 2/5 (40%) | ||
| Ig strand F | 123..131 | CDD:409353 | 3/7 (43%) | ||
| CDR3 | 132..136 | CDD:409353 | 0/3 (0%) | ||
| Ig strand G | 136..145 | CDD:409353 | 3/9 (33%) | ||
| FR4 | 138..145 | CDD:409353 | 2/6 (33%) | ||
| Ig_3 | 148..218 | CDD:404760 | 27/74 (36%) | ||
| Ig strand A' | 155..160 | CDD:409353 | 0/4 (0%) | ||
| Ig strand B | 166..173 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 179..184 | CDD:409353 | 2/4 (50%) | ||
| Ig strand D | 190..193 | CDD:409353 | 0/2 (0%) | ||
| Ig strand E | 197..203 | CDD:409353 | 2/5 (40%) | ||
| Ig strand F | 210..217 | CDD:409353 | 3/6 (50%) | ||
| Ig strand G | 224..232 | CDD:409353 | 2/7 (29%) | ||
| Ig_3 | 235..311 | CDD:404760 | 22/81 (27%) | ||
| Ig strand B | 252..256 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 265..269 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 290..294 | CDD:409353 | 2/8 (25%) | ||
| Ig strand F | 304..309 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 318..321 | CDD:409353 | 1/2 (50%) | ||
| Ama | NP_731114.2 | I-set | 33..143 | CDD:254352 | 27/101 (27%) |
| Ig | 37..127 | CDD:299845 | 23/85 (27%) | ||
| IG_like | 154..234 | CDD:214653 | 26/80 (33%) | ||
| IGc2 | 161..223 | CDD:197706 | 23/62 (37%) | ||
| I-set | 254..330 | CDD:254352 | 25/75 (33%) | ||
| IGc2 | 254..322 | CDD:197706 | 21/67 (31%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C166337161 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D265311at33208 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0000150 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR42757 |
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 1 | 1.000 | - | - | X97 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 7 | 6.850 | |||||