DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lsamp and DIP-theta

DIOPT Version :9

Sequence 1:XP_038944182.1 Gene:Lsamp / 29561 RGDID:71102 Length:378 Species:Rattus norvegicus
Sequence 2:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster


Alignment Length:340 Identity:104/340 - (30%)
Similarity:159/340 - (46%) Gaps:46/340 - (13%)


- Green bases have known domain annotations that are detailed below.


  Rat    51 FNRGTDNITVRQGDTAILRCVVED-KNSKVAWLN---------RSGIIFAGHDKWSLDPRVELEK 105
            |.....|:||.....|:|:|||:: :..|:|||.         ::.:|...|       |:.:..
  Fly   132 FGELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNH-------RMSITH 189

  Rat   106 RHALEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQV-YLIVQVPPKISN--ISSDVTVNEGSNVT 167
            .....:.|||:.|...|:|.|.|.:.|  :|..||| ||.|.|||.|.:  .|:|:.:.||||||
  Fly   190 AEKRAWILRIRDVKESDKGWYMCQINT--DPMKSQVGYLDVVVPPDILDYPTSTDMVIREGSNVT 252

  Rat   168 LVCMANGRPEPVITWR----HLTPL--GRE---FEGEEEYLEILGITREQSGKYECKAANEVSSA 223
            |.|.|.|.|.|.||||    .|.||  |.|   :.|  .:|.|..:.|...|.|.|.|:|.:...
  Fly   253 LKCAATGSPTPTITWRREGGELIPLPNGAEAVAYNG--SFLTIAKVNRLNMGAYLCIASNGIPPT 315

  Rat   224 DVKQVKVTVNYPPTI-TESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTE 287
            ..|:|.:.|::||.| .:::...|...:..:|:|::.|.|.....|.::||.|........::.|
  Fly   316 VSKRVMLIVHFPPMIWIQNQLVGAALTQNITLECQSEAYPKSINYWMKNDTIIVPGERFVPETFE 380

  Rat   288 G----QSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLF--------KRVLPTVPHPIQEIGTT 340
            .    ...||:..|..:.:|.|.|||.|.||.|:.::.|:        ..:.|||......:...
  Fly   381 SGYKITMRLTIYEVDIQDFGAYRCVAKNSLGDTDGAIKLYHIPQTTTMTTMAPTVSINTVPVVLV 445

  Rat   341 VHFKQKGPGSVRGIN 355
            .:.|::..||.:..|
  Fly   446 KYNKEQRYGSSQNSN 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LsampXP_038944182.1 Ig 55..145 CDD:416386 30/100 (30%)
FR1 55..71 CDD:409353 5/15 (33%)
Ig strand A' 56..62 CDD:409353 3/5 (60%)
Ig strand B 64..72 CDD:409353 3/7 (43%)
CDR1 72..76 CDD:409353 1/4 (25%)
FR2 77..84 CDD:409353 4/15 (27%)
Ig strand C 77..83 CDD:409353 3/5 (60%)
CDR2 85..95 CDD:409353 2/9 (22%)
Ig strand C' 87..90 CDD:409353 1/2 (50%)
Ig strand C' 92..95 CDD:409353 1/2 (50%)
FR3 96..131 CDD:409353 9/34 (26%)
Ig strand D 100..107 CDD:409353 1/6 (17%)
Ig strand E 110..116 CDD:409353 2/5 (40%)
Ig strand F 123..131 CDD:409353 3/7 (43%)
CDR3 132..136 CDD:409353 1/3 (33%)
Ig strand G 136..145 CDD:409353 6/9 (67%)
FR4 138..145 CDD:409353 5/7 (71%)
Ig_3 148..218 CDD:404760 34/80 (43%)
Ig strand A' 155..160 CDD:409353 2/4 (50%)
Ig strand B 166..173 CDD:409353 4/6 (67%)
Ig strand C 179..184 CDD:409353 4/8 (50%)
Ig strand D 190..193 CDD:409353 1/5 (20%)
Ig strand E 197..203 CDD:409353 2/5 (40%)
Ig strand F 210..217 CDD:409353 3/6 (50%)
Ig strand G 224..232 CDD:409353 2/7 (29%)
Ig_3 235..311 CDD:404760 21/80 (26%)
Ig strand B 252..256 CDD:409353 1/3 (33%)
Ig strand C 265..269 CDD:409353 0/3 (0%)
Ig strand E 290..294 CDD:409353 1/3 (33%)
Ig strand F 304..309 CDD:409353 2/4 (50%)
Ig strand G 318..321 CDD:409353 0/2 (0%)
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 31/101 (31%)
IG_like 137..230 CDD:214653 31/101 (31%)
IG_like 240..324 CDD:214653 34/85 (40%)
IGc2 247..310 CDD:197706 29/64 (45%)
Ig 327..419 CDD:299845 25/91 (27%)
IG_like 343..420 CDD:214653 21/76 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10374
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4382
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8971
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.