DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdx1 and ftz

DIOPT Version :9

Sequence 1:NP_074043.4 Gene:Pdx1 / 29535 RGDID:62387 Length:283 Species:Rattus norvegicus
Sequence 2:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster


Alignment Length:200 Identity:68/200 - (34%)
Similarity:93/200 - (46%) Gaps:50/200 - (25%)


- Green bases have known domain annotations that are detailed below.


  Rat    61 SPPDISPYEVPPLADDPAGAHLHHHLPAQLGLAHPPPGPFPNGTETGGLEEPSR-VHLP-----F 119
            :||..:|..:|||.                |::.||..|....:.....|...| |..|     |
  Fly   190 TPPPTTPTSLPPLE----------------GISTPPQSPGEKSSSAVSQEINHRIVTAPNGAGDF 238

  Rat   120 PWMKSTKAHAWKSQWAGGAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLN 184
            .|     :|..::      .|::.:::||||..|||.|.|||||||.||:||:|.||:::|..|:
  Fly   239 NW-----SHIEET------LA
SDCKDSKRTRQTYTRYQTLELEKEFHFNRYITRRRRIDIANALS 292

  Rat   185 LTERHIKIWFQNRRMKWKKEEDKKRSSGTTSGGGGGEEPEQDCAVTSGEELLALPPPPPPGGAVP 249
            |:||.|||||||||||.||:.....|            ||. |    |....|:.||........
  Fly   293 LSERQIKIWFQNRRMKSKKDRTLDSS------------PEH-C----GAGYTAMLPPLEATSTAT 340

  Rat   250 SGVPA 254
            :|.|:
  Fly   341 TGAPS 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdx1NP_074043.4 Transactivation domain 13..73 4/11 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..81 6/19 (32%)
Antp-type hexapeptide 118..123 3/9 (33%)
Homeobox 149..203 CDD:395001 36/53 (68%)
Nuclear localization signal. /evidence=ECO:0000250 197..203 4/5 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..283 12/53 (23%)
ftzNP_477498.1 FTZ 1..248 CDD:281812 17/84 (20%)
Homeobox 257..310 CDD:278475 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.