DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdx1 and unpg

DIOPT Version :9

Sequence 1:NP_074043.4 Gene:Pdx1 / 29535 RGDID:62387 Length:283 Species:Rattus norvegicus
Sequence 2:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster


Alignment Length:336 Identity:85/336 - (25%)
Similarity:123/336 - (36%) Gaps:126/336 - (37%)


- Green bases have known domain annotations that are detailed below.


  Rat     7 YYA-----ATQLYKDPCAFQRGPV-------PEFSANPPACLYMGRQPPPPPPPQFAGSLGTLEQ 59
            |:|     .|.|....|.....|.       |:..|.|        |||||.||..|     ||:
  Fly    92 YFAQNHERLTHLIAGGCYLPSSPAGHPAAQQPQAQAQP--------QPPPPHPPTHA-----LEK 143

  Rat    60 GSPPDI-SPYEVPPLADDPAGA-------------------HLH--------HHL---------- 86
            ..||.: .|.:...|..:||.|                   ::|        .|:          
  Fly   144 QLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQ 208

  Rat    87 --PAQLGLAHPPP-----GPFPNGTETG-------GLEEP--------SRVHLPFP------WMK 123
              |....|..|.|     .|..:|:.:.       |::|.        |.:.|...      .|.
  Fly   209 ANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMD 273

  Rat   124 STKAHAW--------------KSQWAGGAYAAEPEE---------NKRTRTAYTRAQLLELEKEF 165
            .::..|:              :|:..||....:..:         ::|.|||:|..||||||:||
  Fly   274 KSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREF 338

  Rat   166 LFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRSSGTTSGGGGGEEPEQDCAVT 230
            ...||:|...|.::|..|.|:|..:||||||||.|||:.:     :|.||.|.|..      ..|
  Fly   339 HAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVK-----AGLTSHGLGRN------GTT 392

  Rat   231 SGEELLALPPP 241
            ||.::: :|.|
  Fly   393 SGTKIV-VPIP 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdx1NP_074043.4 Transactivation domain 13..73 19/67 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..81 17/64 (27%)
Antp-type hexapeptide 118..123 0/10 (0%)
Homeobox 149..203 CDD:395001 30/53 (57%)
Nuclear localization signal. /evidence=ECO:0000250 197..203 4/5 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..283 12/41 (29%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 28/50 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.