DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTT2 and GstD4

DIOPT Version :9

Sequence 1:NP_000845.2 Gene:GSTT2 / 2953 HGNCID:4642 Length:244 Species:Homo sapiens
Sequence 2:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster


Alignment Length:184 Identity:53/184 - (28%)
Similarity:95/184 - (51%) Gaps:11/184 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    11 SQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLS 75
            |..||.:.:.||..|:.|..:.:.:.:|:|...|||::|....:|||.|..|.:.||.||.:||.
  Fly     9 SSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWESRAIAVYLV 73

Human    76 CKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGV-QVPKEKVERNRTAM 139
            .||...|..:|:|.|.||.:::.|.:....:..:|     ::...|.|.. |:...:   |...:
  Fly    74 EKYGKDDSLFPNDPQKRALINQRLYFDMGTLHDSF-----MKYYYPFIRTGQLGNAE---NYKKV 130

Human   140 DQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAW 193
            :.|.::| |.||..:.::||.|:|:||:..|..:.....:.:::.: .|.:|.|
  Fly   131 EAAFEFL-DIFLEGQDYVAGSQLTVADIAILSSVSTFEVVEFDISK-YPNVARW 182

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 24/66 (36%)
GstA 14..210 CDD:223698 52/181 (29%)