DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTT2 and GstD3

DIOPT Version :9

Sequence 1:NP_000845.2 Gene:GSTT2 / 2953 HGNCID:4642 Length:244 Species:Homo sapiens
Sequence 2:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster


Alignment Length:177 Identity:47/177 - (26%)
Similarity:87/177 - (49%) Gaps:9/177 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    22 KKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYP 86
            |..|:....:.::.:||:..:.:|::||....:|||.|..|.:.||.|||:||..||...|..||
  Fly     4 KALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYP 68

Human    87 SDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPKEKVERNRTAMDQALQWLEDKFL 151
            .|:|.:|.:::.|.:....:..|.....:........|.:...:||:       :...:| :.||
  Fly    69 KDIQKQAVINQRLYFDMALMYPTLANYYYKAFTTGQFGSEEDYKKVQ-------ETFDFL-NTFL 125

Human   152 GDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVE 198
            ..:.::||.|.|:||:..|..:.....:|:::.: .|.:|.|...|:
  Fly   126 EGQDYVAGDQYTVADIAILANVSNFDVVGFDISK-YPNVARWYDHVK 171

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 19/55 (35%)
GstA 14..210 CDD:223698 47/177 (27%)