DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTT2 and GstD9

DIOPT Version :9

Sequence 1:NP_000845.2 Gene:GSTT2 / 2953 HGNCID:4642 Length:244 Species:Homo sapiens
Sequence 2:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster


Alignment Length:197 Identity:59/197 - (29%)
Similarity:91/197 - (46%) Gaps:19/197 - (9%)


- Green bases have known domain annotations that are detailed below.


Human     3 LELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTES 67
            |:.:..|.|.|.|::.:.|:..|:.|..:.|||..|:|...||::||....:|||.|..|.:.||
  Fly     2 LDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWES 66

Human    68 SAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPKEKV 132
            .||||||:.||......||.|.|.||.:::.|.:....:..::....:.|:.          |.|
  Fly    67 RAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLF----------EDV 121

Human   133 ERNRTAMDQALQWLEDKFLGDRPFLAGQQ------VTLADLMALEELMQPVALGYELFEGRPRLA 191
            :  :.|....|:.::|.|......|.|||      :||||...|..:.......|: |...|.:.
  Fly   122 K--KPADPDNLKKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEISEYD-FGKYPEVV 183

Human   192 AW 193
            .|
  Fly   184 RW 185

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 30/74 (41%)
GstA 14..210 CDD:223698 55/186 (30%)