DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTT2 and GstE11

DIOPT Version :9

Sequence 1:NP_000845.2 Gene:GSTT2 / 2953 HGNCID:4642 Length:244 Species:Homo sapiens
Sequence 2:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster


Alignment Length:196 Identity:63/196 - (32%)
Similarity:97/196 - (49%) Gaps:19/196 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    11 SQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLS 75
            |.|.|||.:.|...|:.|:||.|::..|:|||.|||::|:...:|.|.|...|:::|..|..||:
  Fly    13 SPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHIICSYLA 77

Human    76 CKY--QTPDHWYPSDLQARARVHEYLGWHADCIRGTFG--IPLWVQVLGPLI---GVQVPKEKVE 133
            .||  :..|..||.|.:.|..|...|  :.||     |  .|....::.|:|   ..:||.::|.
  Fly    78 DKYAPEGDDSLYPKDPEKRRLVDARL--YYDC-----GHLFPRIRFIVEPVIYFGAGEVPSDRVA 135

Human   134 RNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVE 198
            ..:.|.|.....|.:   ||  :|.|.::|:|||..:..:....|......:..|||..|..|::
  Fly   136 YLQKAYDGLEHCLAE---GD--YLVGDKLTIADLSCIASVSTAEAFAPIEPDQFPRLVQWVKRIQ 195

Human   199 A 199
            |
  Fly   196 A 196

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 27/66 (41%)
GstA 14..210 CDD:223698 61/193 (32%)