DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTT2 and GstE5

DIOPT Version :9

Sequence 1:NP_000845.2 Gene:GSTT2 / 2953 HGNCID:4642 Length:244 Species:Homo sapiens
Sequence 2:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster


Alignment Length:220 Identity:63/220 - (28%)
Similarity:100/220 - (45%) Gaps:31/220 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    11 SQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLS 75
            |.|.|||.:......:|.|...|::...:..|:|:|:.|....:|||:|....:.:|.||:.||.
  Fly    12 SPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYIWDSHAIIAYLV 76

Human    76 CKYQTPDHWYPSDLQARARVHEYLGWHADCI--RGTFGI--PLWVQVLGPLIGVQVPKEKVERNR 136
            .||...|..||.||..||.|.:.|.:....:  .|...|  ||:...|.     ::|||:.:   
  Fly    77 SKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFFNGLN-----RIPKERYD--- 133

Human   137 TAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVA------LGYELFEGRPRLAAWRG 195
             |:.:...::| .||....::||.|:|:||...:..:...||      |.|      ||:..|..
  Fly   134 -AIVEIYDFVE-TFLAGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKY------PRIIEWVR 190

Human   196 RVEAF-----LGAELCQEAHSIILS 215
            |:|..     ..|:..:|..:|:.|
  Fly   191 RLEKLPYYEEANAKGARELETILKS 215

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 21/66 (32%)
GstA 14..210 CDD:223698 59/210 (28%)