DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTT2 and GstE4

DIOPT Version :9

Sequence 1:NP_000845.2 Gene:GSTT2 / 2953 HGNCID:4642 Length:244 Species:Homo sapiens
Sequence 2:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster


Alignment Length:202 Identity:59/202 - (29%)
Similarity:97/202 - (48%) Gaps:34/202 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    11 SQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLS 75
            |.|:||..:..|...:|.|...|:|.:.::.|::|.:.|....:|.|:|.|..:.:|.||:.||.
  Fly    12 SPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACIWDSHAIMAYLV 76

Human    76 CKYQTPDHWYPSDLQARARVHEYLGWHADCI------RGT-----FGIPLWVQVLGPLIGVQVPK 129
            .||...|..||.||..||:|.:.:.:.:..|      |.|     ||.|            .:|:
  Fly    77 EKYAPSDELYPKDLLQRAKVDQLMHFESGVIFESALRRLTRPVLFFGEP------------TLPR 129

Human   130 EKVERNRTAMDQALQWLE--DKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGR-PRLA 191
            .:|       |..||..:  :.||.|..|:||.|:|:|| .::...:..:.:..||...: |::|
  Fly   130 NQV-------DHILQVYDFVETFLDDHDFVAGDQLTIAD-FSIVSTITSIGVFLELDPAKYPKIA 186

Human   192 AWRGRVE 198
            ||..|::
  Fly   187 AWLERLK 193

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 21/66 (32%)
GstA 14..210 CDD:223698 57/199 (29%)