DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTT2 and GstE2

DIOPT Version :9

Sequence 1:NP_000845.2 Gene:GSTT2 / 2953 HGNCID:4642 Length:244 Species:Homo sapiens
Sequence 2:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster


Alignment Length:197 Identity:61/197 - (30%)
Similarity:95/197 - (48%) Gaps:25/197 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    10 VSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYL 74
            :|.|.||..:..:...:..|.:.:||:.|.|....||:.|....:|.|:|...::.:|.||:.||
  Fly    12 ISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWDSHAIVCYL 76

Human    75 SCKYQTPDHWYPSDLQARARVHEYLGWHADCI---RGTFGIPLWVQVLGPLIGVQVPKEKVERNR 136
            ..||...|..||.||..||:|.:.|.:.|..:   .....||.:::.:.     .||||||:..:
  Fly    77 VDKYANSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQVS-----LVPKEKVDNIK 136

Human   137 TAMDQALQWLEDKFLGDRPFLAGQQVTLADL------MALEELMQPVALGYELFEGRPRLAAWRG 195
            .|....     :.||||.|:|.|.|:|:|||      .:|..::....|.|      |::|||..
  Fly   137 DAYGHL-----ENFLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDELKY------PKVAAWFE 190

Human   196 RV 197
            |:
  Fly   191 RL 192

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 20/67 (30%)
GstA 14..210 CDD:223698 59/193 (31%)