DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTT2 and GstE1

DIOPT Version :9

Sequence 1:NP_000845.2 Gene:GSTT2 / 2953 HGNCID:4642 Length:244 Species:Homo sapiens
Sequence 2:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster


Alignment Length:201 Identity:66/201 - (32%)
Similarity:101/201 - (50%) Gaps:17/201 - (8%)


- Green bases have known domain annotations that are detailed below.


Human     2 GLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTE 66
            |:.|:...:|...|.|.:..|...:..|.:.|:|..|:|.|:|:::.|....:|.|.|....:.:
  Fly     5 GIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWD 69

Human    67 SSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTF---GIPLWVQVLGPLIGV-QV 127
            |.||..||..||...|..||.||..||.|::.|.:.|..|..:.   ..|.|:.      || :|
  Fly    70 SHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWIN------GVTEV 128

Human   128 PKEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQ-PVALGYELFEGRPRLA 191
            |:||::    |:.|.|:.|| .|||:.|:|||..:|||||.....:.. |.|:..:. ...|::.
  Fly   129 PQEKLD----AVHQGLKLLE-TFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDP-ATYPKVT 187

Human   192 AWRGRV 197
            ||..|:
  Fly   188 AWLDRL 193

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 21/74 (28%)
GstA 14..210 CDD:223698 63/189 (33%)