DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTT2 and GstE10

DIOPT Version :9

Sequence 1:NP_000845.2 Gene:GSTT2 / 2953 HGNCID:4642 Length:244 Species:Homo sapiens
Sequence 2:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster


Alignment Length:194 Identity:56/194 - (28%)
Similarity:94/194 - (48%) Gaps:15/194 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    11 SQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLS 75
            |.|.|||.:..:...:..|..|:|:..|.|...:.|:.|....:|.|:||:..:.:|.||:.||.
  Fly    12 SPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLEDGESCIWDSHAIIGYLV 76

Human    76 CKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLI---GVQVPKEKVERNRT 137
            .||...|..||.|...||.|.:.|.:..    |.....::.|:...|.   ..:|||:::...:.
  Fly    77 NKYAQSDELYPKDPLKRAVVDQRLHFET----GVLFHGIFKQLQRALFKENATEVPKDRLAELKD 137

Human   138 AMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGR--PRLAAWRGRVEA 199
            |..     |.::||.:.|::||.|:|:|| .::...:..:.|.|...:..  |:|:||..|:.|
  Fly   138 AYA-----LLEQFLAENPYVAGPQLTIAD-FSIVATVSTLHLSYCPVDATKYPKLSAWLARISA 195

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 21/66 (32%)
GstA 14..210 CDD:223698 54/191 (28%)