DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTT2 and GstE14

DIOPT Version :9

Sequence 1:NP_000845.2 Gene:GSTT2 / 2953 HGNCID:4642 Length:244 Species:Homo sapiens
Sequence 2:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster


Alignment Length:197 Identity:63/197 - (31%)
Similarity:95/197 - (48%) Gaps:24/197 - (12%)


- Green bases have known domain annotations that are detailed below.


Human     5 LFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSA 69
            |:.|..|.|.|:..:..|...|.:|||.|:|.||:...|:||.:|....:|||..||.:||:|.|
  Fly     8 LYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTDSHA 72

Human    70 ILIYLSCKYQTPDHWYPSDLQARARVHEYLGWH--------ADCIRGTFGIPLWVQVLGPLIGVQ 126
            |||:|:.|:......:|.:...|.:|...|.:.        :|.:..|        |......|.
  Fly    73 ILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMSAT--------VRQGFANVD 129

Human   127 VPKEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLA 191
            |...  ||..|   :|...:| ::|.:..|:||.|:||||| ::...:..|.|.:.|.: .|||.
  Fly   130 VAHH--ERKLT---EAYIIME-RYLENSDFMAGPQLTLADL-SIVTTLSTVNLMFPLSQ-FPRLR 186

Human   192 AW 193
            .|
  Fly   187 RW 188

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 31/72 (43%)
GstA 14..210 CDD:223698 59/188 (31%)