DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTT1 and GstD10

DIOPT Version :9

Sequence 1:NP_000844.2 Gene:GSTT1 / 2952 HGNCID:4641 Length:240 Species:Homo sapiens
Sequence 2:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster


Alignment Length:199 Identity:53/199 - (26%)
Similarity:101/199 - (50%) Gaps:13/199 - (6%)


- Green bases have known domain annotations that are detailed below.


Human     3 LELYLDLLSQPCRAVYIFAKKNDIPFELR-IVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTE 66
            ::||....|.|||:|.:.||...:.|:.: |::....:..:..:.::||...:|.|.|..|.|.|
  Fly     1 MDLYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWE 65

Human    67 SVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFP-VFLGEPVSP 130
            |.||::||..||...|..:|:|:|.:|.:::.|.:...||.:|     :.:..:| :||.:|.:.
  Fly    66 SRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKS-----FSEYYYPQIFLKKPANE 125

Human   131 QTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWR 195
            :    ...:::|..:.| :.||:.:.:..|...||||:..:..:.....||.. |:....:|.|.
  Fly   126 E----NYKKIEVAFEFL-NTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGFD-FKRYANVARWY 184

Human   196 QRVE 199
            :..:
  Fly   185 ENAK 188

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTT1NP_000844.2 GST_N_Theta 3..78 CDD:239348 24/75 (32%)