DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTT1 and GstD7

DIOPT Version :9

Sequence 1:NP_000844.2 Gene:GSTT1 / 2952 HGNCID:4641 Length:240 Species:Homo sapiens
Sequence 2:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster


Alignment Length:236 Identity:61/236 - (25%)
Similarity:105/236 - (44%) Gaps:36/236 - (15%)


- Green bases have known domain annotations that are detailed below.


Human     3 LELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTES 67
            |:||...::...||:.:.||...:....::::.::|..|...|.::||...:|.|.|..|.:.||
  Fly     4 LDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWES 68

Human    68 VAILLYLTRKYKVPDY-WYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQ 131
            .||.:||..||..||. .||.|.|.||.:::.|.:...||..:..     |..|.:|.......|
  Fly    69 RAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALT-----KYFFLIFRTGKFGDQ 128

Human   132 TLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVF----------- 185
               ..|.:::.....| :.||:.:.|:.|..:::||:|.:..:     :..:.|           
  Fly   129 ---EALDKVNSAFGFL-NTFLEGQDFVAGSQLTVADIVILATV-----STVEWFSFDLSKFPNVE 184

Human   186 ---EGRPKLAT-WRQRVEAAVG-----EDLFQEAHEVILKA 217
               :..||:.. |.|.:|:...     :|| |.|.|..:||
  Fly   185 RWLKNAPKVTPGWEQNLESLQQGKKFLQDL-QAAKEKEVKA 224

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTT1NP_000844.2 GST_N_Theta 3..78 CDD:239348 22/74 (30%)