DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTT1 and GstD4

DIOPT Version :9

Sequence 1:NP_000844.2 Gene:GSTT1 / 2952 HGNCID:4641 Length:240 Species:Homo sapiens
Sequence 2:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster


Alignment Length:203 Identity:50/203 - (24%)
Similarity:88/203 - (43%) Gaps:32/203 - (15%)


- Green bases have known domain annotations that are detailed below.


Human     3 LELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTES 67
            ::.|....|...|.:.:.||...:....:.:.:.:|:||...|.::||...:|.|.|..|.:.||
  Fly     1 MDFYYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWES 65

Human    68 VAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVF----LGEPV 128
            .||.:||..||...|..:|.|.|.||.:::.|.:...||..|.:     |..:|..    ||...
  Fly    66 RAIAVYLVEKYGKDDSLFPNDPQKRALINQRLYFDMGTLHDSFM-----KYYYPFIRTGQLGNAE 125

Human   129 SPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFE------- 186
            :.:.:.|....||:        ||:.:.::.|..:::||:..::.:        ..||       
  Fly   126 NYKKVEAAFEFLDI--------FLEGQDYVAGSQLTVADIAILSSV--------STFEVVEFDIS 174

Human   187 GRPKLATW 194
            ..|.:|.|
  Fly   175 KYPNVARW 182

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTT1NP_000844.2 GST_N_Theta 3..78 CDD:239348 21/74 (28%)