DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTT1 and GstD9

DIOPT Version :9

Sequence 1:NP_000844.2 Gene:GSTT1 / 2952 HGNCID:4641 Length:240 Species:Homo sapiens
Sequence 2:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster


Alignment Length:213 Identity:57/213 - (26%)
Similarity:93/213 - (43%) Gaps:34/213 - (15%)


- Green bases have known domain annotations that are detailed below.


Human     3 LELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTES 67
            |:.|..|.|.|||::.:.|:...:....:.|||..|:||...|.::||...:|.|.|..|.:.||
  Fly     2 LDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWES 66

Human    68 VAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQT 132
            .|||:||..||......||:|.|.||.:::.|.:..:||.:|.:...:.::...|  .:|..|. 
  Fly    67 RAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDV--KKPADPD- 128

Human   133 LAATLAELDVTLQLLEDKFLQNKAFLTGPH------ISLADLVAITELMHPVGAGCQVFE----- 186
                      .|:.::|.|......|.|..      ::|||...:        |....||     
  Fly   129 ----------NLKKIDDAFAMFNTLLKGQQYAALNKLTLADFALL--------ATVSTFEISEYD 175

Human   187 -GR-PKLATWRQRVEAAV 202
             |: |::..|....:..:
  Fly   176 FGKYPEVVRWYDNAKKVI 193

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTT1NP_000844.2 GST_N_Theta 3..78 CDD:239348 28/74 (38%)