DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTT1 and gfzf

DIOPT Version :9

Sequence 1:NP_000844.2 Gene:GSTT1 / 2952 HGNCID:4641 Length:240 Species:Homo sapiens
Sequence 2:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster


Alignment Length:183 Identity:54/183 - (29%)
Similarity:84/183 - (45%) Gaps:33/183 - (18%)


- Green bases have known domain annotations that are detailed below.


Human     3 LELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTES 67
            ::||......|..||.:..|..||.::|..||....:|.|:.::::||.|::|.|.|..|.|:||
  Fly   812 MKLYAVSDGPPSLAVRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGFYLSES 876

Human    68 VAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQ----------HTTLRRSCLRALWHKVMFPV 122
            :||:.||..||......||||:..||.:::.|.:.          |:              |.|:
  Fly   877 IAIMQYLCDKYAPDSTLYPQDVNVRAVINQRLCFNMGFYYAPISAHS--------------MAPI 927

Human   123 FLGEPVSPQTLAATLAELDV---TLQLLEDKFLQNKAFLTGPHISLADLVAIT 172
            |.....:|.:|......|||   .||.|..|      :..|.:|::||...|:
  Fly   928 FFDYKRTPMSLKKVQNALDVFETYLQRLGTK------YAAGENITIADFALIS 974

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTT1NP_000844.2 GST_N_Theta 3..78 CDD:239348 27/74 (36%)