DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTT1 and GstE12

DIOPT Version :9

Sequence 1:NP_000844.2 Gene:GSTT1 / 2952 HGNCID:4641 Length:240 Species:Homo sapiens
Sequence 2:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster


Alignment Length:229 Identity:72/229 - (31%)
Similarity:111/229 - (48%) Gaps:33/229 - (14%)


- Green bases have known domain annotations that are detailed below.


Human     5 LYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTESVA 69
            ||...||.|.|||.:.||...:..|||.::|:||:||:..|.::||...:|.|.||:.|:.:|.|
  Fly     6 LYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHA 70

Human    70 ILLYLTRKY-KVPDYWYPQDLQARARVDE--YLAWQHTTLRRSCLRALWHKVMFPVFLGEPV--- 128
            |..||..|| :.....||::|..||.||.  :|...|...|   ||          ||.||:   
  Fly    71 ICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFAR---LR----------FLYEPILYY 122

Human   129 -SPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGR-PKL 191
             |.......:|.:....::||. ||:::.:|.|..:::||..|:..:. .|.....:.|.: ||:
  Fly   123 GSTDCSIDKIAYIQKCWEILEG-FLKDQPYLCGSDLTIADFCAVATVT-SVNDTAPIDEFKFPKM 185

Human   192 ATWRQRVEAAVGEDLFQEAH-------EVILKAK 218
            ..|.:|:...   ..:||.:       :.|.|||
  Fly   186 HAWLKRLAEL---PYYQEVNGDGADELKSIFKAK 216

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTT1NP_000844.2 GST_N_Theta 3..78 CDD:239348 31/72 (43%)