DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTT1 and GstE11

DIOPT Version :9

Sequence 1:NP_000844.2 Gene:GSTT1 / 2952 HGNCID:4641 Length:240 Species:Homo sapiens
Sequence 2:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster


Alignment Length:211 Identity:59/211 - (27%)
Similarity:93/211 - (44%) Gaps:36/211 - (17%)


- Green bases have known domain annotations that are detailed below.


Human     5 LYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTESVA 69
            ||....|.|||||.:.|....:..:||:|::..|:|.|..|.::|....:|.|.|....:::|..
  Fly     7 LYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHI 71

Human    70 ILLYLTRKY--KVPDYWYPQDLQARARVDEYLAWQ--HTTLRRSCLRALWHKVMFP--VFLGEPV 128
            |..||..||  :..|..||:|.:.|..||..|.:.  |               :||  .|:.|||
  Fly    72 ICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGH---------------LFPRIRFIVEPV 121

Human   129 ----SPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADL-----VAITELMHPVGAGCQV 184
                :.:..:..:|.|......|| ..|....:|.|..:::|||     |:..|...|:..    
  Fly   122 IYFGAGEVPSDRVAYLQKAYDGLE-HCLAEGDYLVGDKLTIADLSCIASVSTAEAFAPIEP---- 181

Human   185 FEGRPKLATWRQRVEA 200
             :..|:|..|.:|::|
  Fly   182 -DQFPRLVQWVKRIQA 196

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTT1NP_000844.2 GST_N_Theta 3..78 CDD:239348 24/72 (33%)