DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTT1 and GstE8

DIOPT Version :9

Sequence 1:NP_000844.2 Gene:GSTT1 / 2952 HGNCID:4641 Length:240 Species:Homo sapiens
Sequence 2:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster


Alignment Length:205 Identity:56/205 - (27%)
Similarity:89/205 - (43%) Gaps:23/205 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     3 LELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTES 67
            |.||....|.|.||..:......||:|...::.:..:.||..|.:.||...||.|:|....:.:|
  Fly     4 LILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIWDS 68

Human    68 VAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVF-LGEPVSPQ 131
            .||..||..||...|..||:||..||.||:.|.::...:..:.||.    :..|:| .|:...|:
  Fly    69 HAISAYLVSKYGQSDTLYPKDLLQRAVVDQRLHFESGVVFVNGLRG----ITKPLFATGQTTIPK 129

Human   132 TLAATLAELDVTLQLLE--DKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVF-----EGRP 189
                  ...|..:::.:  :.||....|:.|..:::||...||.:     ....||     ....
  Fly   130 ------ERYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSI-----TALAVFVVIDTVKYA 183

Human   190 KLATWRQRVE 199
            .:..|.:|:|
  Fly   184 NITAWIKRIE 193

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTT1NP_000844.2 GST_N_Theta 3..78 CDD:239348 24/74 (32%)